SecReT6
Protein ID: 238023640
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01490
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]167381..169438 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC5ALD6
KEGG IDbgl:bglu_2g01490
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-82, Aligned region: 40..366
Phage_base_V [PF04717], Evalue: 2.50E-25, Aligned region: 406..499
DUF2345 [PF10106], Evalue: 0.0023, Aligned region: 594..675
Protein Sequence: 685 a.a.     [Download]
>gi|238023640|ref|YP_002907872.1| unnamed protein product [Burkholderia glumae BGR1]
MTVDSKIMDARSRTVSVTSAAIPQVLGHAALEFMAMEGSEELGKLFDYKVLLRTPDDYAIPLAASANLGL
SAMLGKELTVSIQLDAPAGAQGTAQGAVREITGLVTKSEFVRREGRFNVYRVTLKPWLWLATLTTDYRIF
QDKTVIEILDTILGEYPYPVEKRLDVSRYVLMGESERNEPRAYQVQYGESDFRFMQRLMEEWGIYWFIEH
SDGKQRLVLCDHIGAHRKSPNPAYQKLAFQPQEGKTDAEYISAFSTAEMICPGSYLTNDFDFTWPRADLH
AVNQQARDTDWNTFERYEWPGDYSDSSHGELLARTRMEMLRAPGMRASGEGNLRGLACGQTFELINFDRT
DANREYLVIGTELNVIGNPDESGSGYQYTFSNRFEVQPTSEVFRLPMATPKPFVSGPQSAIVVGPEGETL
WTDEFGRVKVHFAWDRYGRNAETDSCWVRVSQAWAGSNFGSIYIPRIGQEVIVDFWNGDPDRPLILGSLY
NTLTPPPWDLPGNATQSGVMSRSINGGKQNFNAIRFEDKAGAEELLIQAERGMNRLTKLNESLVVGIDFS
VAVGAGYNVEVGGEINCNVLGMASYTVGLAHSLLVGGAQTTAVAGASTLTVGGARSVTVGGASLHTVGGM
YALTAGGEIAISSGKSSLTLCADGTIKLVGRTIRIQGDDRVVVQGSPLDLNPGDA
 
Nucleotide Sequence: 2058 bp     [Download]
>gi|339717964|ref|NC_012721.2|:167381-169438 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGACAGTGGATTCCAAGATCATGGACGCTCGGAGCCGCACGGTCAGCGTGACGAGCGCGGCGATACCGC
AGGTGCTGGGGCATGCCGCGCTGGAATTTATGGCGATGGAGGGTAGCGAGGAACTCGGCAAGCTGTTCGA
TTACAAAGTGCTGCTGCGTACTCCGGACGATTACGCGATACCGCTGGCCGCGAGTGCGAACCTCGGCTTG
AGTGCGATGCTCGGCAAGGAGCTGACCGTGTCGATCCAACTCGACGCGCCGGCTGGTGCGCAGGGCACGG
CACAGGGCGCCGTGCGCGAGATCACCGGGTTGGTCACCAAGTCGGAGTTCGTGCGCCGCGAGGGACGTTT
CAACGTCTATCGCGTGACCCTGAAGCCGTGGTTATGGCTCGCCACGCTGACCACCGACTACCGCATCTTC
CAGGACAAGACGGTGATCGAGATCCTCGACACGATCCTCGGCGAGTATCCGTATCCGGTCGAGAAGCGGC
TCGACGTGAGCCGTTATGTGCTGATGGGCGAGAGCGAGCGGAATGAGCCGCGAGCCTACCAGGTCCAGTA
CGGCGAGTCCGACTTCCGCTTCATGCAGCGTCTGATGGAGGAGTGGGGTATCTACTGGTTCATCGAGCAC
TCCGACGGCAAGCAGCGGCTGGTGTTGTGCGACCACATCGGCGCGCACCGCAAGTCGCCGAACCCGGCGT
ATCAAAAGCTGGCGTTCCAGCCGCAGGAGGGCAAGACCGACGCGGAATATATCAGCGCGTTCTCGACGGC
CGAGATGATCTGCCCGGGCAGCTATTTGACGAACGACTTCGATTTCACGTGGCCGCGGGCGGACTTGCAT
GCGGTCAACCAGCAGGCGCGCGATACCGACTGGAATACGTTCGAGCGCTATGAATGGCCGGGCGACTACA
GCGATAGCAGCCACGGCGAGTTGCTGGCGCGCACGCGCATGGAGATGCTGCGTGCGCCAGGCATGCGCGC
GAGCGGCGAGGGCAACCTGCGCGGGCTCGCGTGCGGGCAGACCTTCGAGCTGATCAATTTCGATCGCACG
GATGCCAACCGCGAATATCTGGTGATAGGCACCGAGCTCAATGTGATCGGCAATCCGGACGAATCGGGCA
GCGGCTATCAGTACACGTTTTCCAATCGCTTCGAGGTACAGCCGACCAGCGAGGTGTTCCGGCTGCCGAT
GGCCACGCCCAAGCCATTCGTGAGCGGCCCGCAGTCGGCCATCGTGGTGGGTCCGGAAGGCGAAACGCTG
TGGACCGACGAGTTTGGTCGCGTGAAGGTGCATTTTGCATGGGACCGCTACGGCCGCAACGCCGAGACCG
ATTCGTGCTGGGTACGGGTGAGCCAGGCCTGGGCGGGCTCCAATTTCGGCAGCATTTATATTCCGCGCAT
CGGTCAGGAAGTGATCGTCGATTTCTGGAATGGCGACCCCGATCGCCCCCTGATCCTCGGCAGTCTCTAC
AACACGCTGACGCCGCCGCCATGGGATCTGCCGGGCAACGCGACGCAGAGCGGCGTGATGAGCCGTTCGA
TCAATGGCGGCAAGCAGAATTTCAACGCCATCCGATTCGAGGACAAGGCGGGAGCCGAAGAGCTTCTGAT
CCAGGCTGAGCGTGGGATGAACCGCCTGACCAAGCTGAACGAGTCGCTCGTTGTGGGCATCGATTTCTCG
GTCGCCGTCGGTGCCGGGTACAACGTCGAGGTGGGCGGGGAGATCAATTGCAACGTGCTGGGCATGGCGT
CCTATACCGTGGGTCTTGCGCACAGCTTGCTGGTGGGTGGGGCGCAGACCACGGCGGTGGCCGGTGCCTC
GACGCTGACCGTGGGCGGGGCGCGATCCGTCACGGTGGGAGGCGCGTCCTTGCATACCGTCGGTGGCATG
TACGCGTTGACCGCGGGTGGCGAGATAGCGATTTCGTCCGGCAAGTCGTCGCTGACGCTATGCGCGGACG
GCACGATCAAGCTGGTCGGCAGAACAATCCGTATTCAGGGCGACGATCGTGTCGTCGTGCAGGGTTCGCC
GCTTGATCTCAACCCGGGTGATGCATAG