SecReT6
Protein ID: 238023641
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01500
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]169629..172157 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC5ALD7
KEGG IDbgl:bglu_2g01500
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-81, Aligned region: 24..349
Phage_base_V [PF04717], Evalue: 3.30E-25, Aligned region: 390..483
DUF2345 [PF10106], Evalue: 0.00045, Aligned region: 579..660
Protein Sequence: 842 a.a.     [Download]
>gi|238023641|ref|YP_002907873.1| unnamed protein product [Burkholderia glumae BGR1]
MTSAAIPQVLGHAALEFMAMEGSEELGKLFDYKVLLRTPDDYVIPLAESANLDLRAMLGKELTVSIELDA
PAGVQGTAQGAVREITGLIIKSEFVRREGRFNVYRVTLKPWLWLATLTTDYRIFQDKTVIEILDTILGEY
PYPVEKRLDVSRYVLMGESERNEPRAYQVQYGESDFRFMQRLMEEWGIYWFIEHSDGKQRLVLCDHVGAH
RKSPNPAYQKLAFQPQEGKTDAEYISAFSTAEMICPGSYLTNDFDFTRPRADLHAVNQQARDTDWNTFER
YEWPGDYSDSHHGELLARTRMEMLRAPGMRASGKGNLRGLACGQTFELINFDRTDANREYLVIGAELKVI
GNPDESGSGYQYRFSNRFKVQPTSEVFRLPMVTRKPFVRGPQSAIVVGPEGETLWTDEFGRVKVHFAWDR
YGRNAETDSCWVRVSQAWAGSNFGSIYIPRIGQEVIVDFWNGDPDRPLILGSLYNTLTPPPWDLPGNATQ
SGVMSRSINGGKQNFNAIRFEDKAGAEEVLIQAEREMNWLTKLNESHVVGVDFSVAVGAAFNVEVGGEVN
CNVLGMASYAVGLAHSLLVGGAQTTAVAGASTLTVGEARSVTVGGASLHTVGGMYALTAGGEISISSGKS
SLTLCADGTIKLIGRTVQIQGDDRVVLQGSPLDLNPGDPDVGIGLAAPTPLVLAALPLPLLLPLPLPLPL
PGPAPEPTPAPEPTPAPEPTPAPEPTPTPEPTPAPEPTPAPEPTPAPEPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPPPTPLPTETPQPSGH
DT
 
Nucleotide Sequence: 2529 bp     [Download]
>gi|339717964|ref|NC_012721.2|:169629-172157 Burkholderia glumae BGR1 chromosome 2, complete sequence
GTGACGAGCGCGGCGATACCGCAGGTGCTGGGGCATGCCGCGCTGGAATTTATGGCGATGGAGGGTAGCG
AGGAACTCGGCAAGCTGTTCGATTACAAAGTGCTGCTGCGTACTCCGGACGATTACGTGATACCGCTGGC
CGAGAGCGCGAATCTCGACTTGCGCGCGATGCTCGGCAAGGAGTTGACCGTGTCGATCGAACTCGATGCG
CCGGCTGGTGTGCAGGGCACGGCACAGGGCGCCGTGCGCGAGATCACCGGGTTGATCATCAAGTCGGAGT
TCGTGCGCCGCGAGGGACGTTTCAACGTCTATCGCGTGACCCTGAAGCCGTGGCTGTGGCTCGCCACGCT
GACCACCGACTACCGCATCTTCCAGGACAAGACGGTGATCGAGATCCTCGACACGATCCTCGGCGAGTAT
CCGTATCCGGTCGAGAAGCGGCTCGACGTGAGCCGTTATGTGCTGATGGGCGAGAGCGAGCGGAATGAGC
CGCGAGCCTACCAGGTCCAGTACGGCGAGTCCGACTTCCGCTTCATGCAGCGCCTGATGGAGGAGTGGGG
CATCTACTGGTTCATCGAGCACTCCGACGGCAAGCAGCGGCTGGTGTTGTGCGACCACGTCGGCGCGCAC
CGCAAGTCGCCGAACCCGGCGTATCAAAAGCTGGCGTTCCAGCCGCAGGAGGGCAAGACCGACGCGGAAT
ATATCAGCGCGTTCTCGACGGCCGAGATGATCTGCCCGGGCAGCTATTTGACGAACGACTTCGATTTCAC
GCGGCCGCGGGCGGATTTGCATGCGGTCAACCAGCAGGCGCGCGATACCGACTGGAATACGTTCGAGCGC
TATGAATGGCCCGGCGACTACAGCGATAGCCATCACGGCGAGTTGCTGGCGCGCACGCGCATGGAAATGC
TGCGTGCGCCAGGCATGCGCGCGAGCGGCAAGGGCAACCTGCGCGGGCTCGCGTGCGGGCAGACCTTCGA
GTTGATCAATTTCGATCGCACGGATGCCAACCGCGAATATCTGGTGATAGGCGCCGAGCTCAAGGTGATC
GGCAACCCGGACGAATCGGGCAGCGGCTATCAGTACAGGTTTTCCAATCGCTTTAAGGTACAGCCGACCA
GCGAGGTGTTCCGGCTGCCGATGGTCACGCGCAAGCCATTCGTGAGGGGGCCGCAGTCGGCCATCGTGGT
GGGTCCGGAAGGCGAAACGCTGTGGACCGACGAGTTTGGTCGCGTGAAGGTGCATTTTGCATGGGACCGC
TATGGCCGCAACGCCGAGACCGATTCGTGCTGGGTACGGGTGAGCCAGGCCTGGGCGGGCTCCAATTTCG
GCAGCATTTATATTCCGCGCATCGGTCAGGAAGTGATCGTCGATTTCTGGAATGGCGACCCCGATCGCCC
CCTGATCCTCGGCAGTCTCTACAACACGCTGACGCCGCCGCCATGGGATCTGCCGGGCAACGCGACGCAG
AGCGGCGTGATGAGCCGTTCGATCAATGGCGGCAAGCAGAATTTCAACGCCATTCGATTCGAGGACAAGG
CGGGAGCCGAAGAGGTCCTGATCCAGGCTGAGCGCGAAATGAACTGGCTGACCAAGCTGAACGAGTCGCA
CGTTGTGGGTGTCGATTTCTCGGTCGCCGTCGGTGCCGCGTTCAACGTCGAGGTGGGCGGGGAAGTCAAT
TGCAACGTGCTGGGCATGGCGTCCTACGCCGTGGGTCTTGCGCACAGCTTGTTGGTGGGTGGGGCGCAGA
CCACGGCGGTGGCCGGTGCCTCGACGCTGACCGTGGGCGAGGCGCGATCCGTCACGGTGGGAGGCGCGTC
CTTGCATACCGTCGGTGGCATGTACGCGTTGACCGCGGGTGGCGAGATATCGATTTCGTCCGGCAAGTCG
TCGCTGACGCTGTGCGCGGACGGCACGATCAAGCTGATCGGCAGGACAGTCCAAATTCAGGGCGACGATC
GCGTCGTCTTGCAGGGTTCGCCGCTCGATCTCAACCCGGGTGATCCTGATGTTGGGATCGGTCTGGCAGC
ACCGACTCCGCTCGTTCTTGCGGCCTTGCCGTTGCCATTGCTGTTGCCGCTGCCGCTGCCGTTACCGTTG
CCGGGGCCGGCCCCTGAACCGACGCCGGCCCCTGAACCGACGCCGGCCCCTGAACCGACGCCGGCCCCTG
AACCGACGCCGACACCTGAGCCGACGCCGGCACCTGAGCCGACGCCGGCCCCTGAACCGACGCCGGCACC
TGAACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACA
CCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGA
CACCGACACCGACACCGACACCGACACCGACACCGACACCGACACCGACGCCGACGCCGACGCCGACGCC
GACGCCGACGCCGACACCGACACCGCCGCCGACGCCGTTACCGACGGAAACGCCGCAGCCCAGCGGTCAC
GACACCTGA