SecReT6
Protein ID: 238023646
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01550
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]178418..179482 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDC5ALE2
KEGG IDbgl:bglu_2g01550
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 198..216
Protein Sequence: 354 a.a.     [Download]
>gi|238023646|ref|YP_002907878.1| unnamed protein product [Burkholderia glumae BGR1]
MTLETPSPATRYTDLLEPVSSDAPCGADLEYDPAFVMLQAAVAPRVEAQYGDFVELPPPANWAEIERECR
ALLLRTKDIRVAVILLRCRVRLEGATGLSDALAFLQSLFERYGEALHPLPVADGERDPVAYVNAIAALAD
HDGVLSDVRDIALPRAAGLKLHLRDVDKALATPRPKDALAPESVVRALRELWNRRDAVLVSLADAQQRLD
TLTAWCAEAFGADAPDLGALARLLQPFAPVRLNGEGSAAPDMPAAPQAAGNDARADAPPSANAAATAQPG
ANDGGTVGALPDDVDRWAALATLRDTRLWFERKEPSSPVIVLLRQCERMVGKRFSELVHLIPADLLAKWD
AIDD
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c179482-178418 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGACACTCGAGACGCCCTCTCCCGCCACCCGTTACACCGATCTGCTCGAACCGGTTTCCTCCGACGCAC
CGTGCGGCGCCGACCTCGAATACGACCCGGCGTTCGTGATGCTGCAAGCGGCCGTGGCGCCACGCGTCGA
GGCTCAGTATGGCGACTTCGTCGAACTGCCGCCGCCTGCCAACTGGGCCGAGATCGAACGCGAATGCCGC
GCCCTGCTGCTGCGCACCAAAGACATCCGGGTCGCGGTGATCCTGCTGCGCTGCCGCGTCCGGCTGGAAG
GCGCGACCGGACTGAGCGATGCGCTGGCGTTTCTCCAGAGCCTGTTCGAGCGCTACGGCGAGGCTCTGCA
CCCGCTGCCGGTGGCAGACGGCGAGCGCGACCCAGTAGCCTATGTCAACGCGATCGCCGCGCTGGCCGAC
CACGACGGCGTGCTCAGCGACGTGCGCGACATCGCGCTGCCGAGAGCCGCGGGTCTCAAGCTGCATCTGC
GCGACGTCGACAAGGCGCTGGCCACGCCTCGCCCCAAGGACGCGCTGGCGCCCGAATCGGTCGTGCGGGC
GCTGCGCGAGCTGTGGAACCGGCGCGACGCGGTGCTGGTTTCCCTGGCCGACGCGCAGCAGCGGCTCGAC
ACGCTCACGGCCTGGTGCGCCGAGGCATTCGGCGCCGACGCGCCTGACCTTGGCGCGCTGGCGCGCCTCC
TTCAACCGTTCGCGCCGGTGCGGCTGAACGGCGAAGGCTCTGCGGCGCCCGACATGCCGGCGGCCCCGCA
GGCCGCCGGCAACGACGCGCGGGCCGATGCGCCGCCTAGCGCAAACGCGGCGGCGACGGCCCAGCCGGGC
GCGAACGATGGGGGCACCGTGGGTGCGCTGCCGGACGACGTCGATCGCTGGGCCGCACTCGCGACGCTGC
GCGACACGCGCCTATGGTTCGAGCGGAAGGAGCCGAGCAGCCCCGTGATCGTGCTGTTGAGACAGTGCGA
GCGGATGGTCGGCAAGCGCTTCTCCGAACTGGTCCATCTGATCCCGGCCGACTTGCTGGCCAAGTGGGAT
GCGATCGACGACTGA