SecReT6
Protein ID: 238023647
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01560
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]179501..180571 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDC5ALE3
KEGG IDbgl:bglu_2g01560
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.30E-97, Aligned region: 36..337
Protein Sequence: 356 a.a.     [Download]
>gi|238023647|ref|YP_002907879.1| unnamed protein product [Burkholderia glumae BGR1]
MSRDPAGVAAPNCGNDIEPPRARLDPGKLRAWFDPDAPWRAGFLSLLRTIAAREPGLRPPGTASRPCDEP
FRIGQQPTLTFAPREIAALGIHDGRLDIRLFGLGLWGPQGPLPLHMTELAYSRVESHQDHALVHLLDVFH
HRALSQFYRAWASAQSIASLDRPDEETFSFYVASLAGTDPDEARRSCLATHARYSAAAHLVREARNPDGI
ATTLSHYFGVPMQVEEFVAHWIRLSDTEHTHIGKPGHASIIGEGALLGEAIPDRQHKFRLVVGPLDLGQY
LRLTPHGADLATFVEWVRAFVGHEYAWEVKLLIKPCEVPPARADTSQRLGYSTWLGEPTHDRPVVGMVFE
PEQYTD
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c180571-179501 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGCCGCGACCCCGCCGGCGTCGCGGCGCCGAATTGCGGCAACGACATCGAGCCTCCCCGAGCGCGGC
TCGATCCGGGCAAACTCAGGGCTTGGTTCGACCCCGATGCGCCGTGGCGGGCCGGCTTCCTCAGCCTGTT
GCGCACGATCGCCGCTCGTGAACCCGGGCTGCGCCCGCCCGGCACGGCGAGCCGGCCGTGCGACGAGCCG
TTCCGGATCGGCCAGCAGCCAACGCTGACGTTCGCGCCGCGCGAGATCGCCGCGCTCGGCATCCACGACG
GCCGCCTCGACATCAGGCTGTTCGGTCTCGGCCTGTGGGGGCCGCAGGGGCCGTTGCCGCTGCATATGAC
GGAGCTCGCGTACAGTCGCGTCGAAAGCCATCAGGATCACGCCCTGGTGCATCTGCTCGACGTGTTTCAC
CACCGCGCCTTGTCGCAGTTCTACCGCGCCTGGGCGTCGGCGCAGAGCATCGCCTCGCTCGACCGGCCCG
ACGAGGAAACCTTCTCGTTCTATGTCGCGAGTCTCGCCGGCACCGATCCGGACGAGGCGCGGCGCTCTTG
CCTGGCCACCCATGCGCGCTACAGCGCGGCGGCGCATCTGGTGCGGGAGGCACGCAACCCGGACGGCATC
GCCACCACGCTGTCGCATTACTTCGGCGTGCCGATGCAGGTCGAGGAATTCGTCGCGCACTGGATCCGGC
TCTCCGATACCGAGCACACGCACATCGGCAAGCCCGGGCATGCCTCGATTATCGGCGAGGGCGCGCTGCT
GGGCGAAGCGATTCCGGACCGGCAGCACAAGTTCCGGTTGGTGGTCGGGCCGCTCGATCTCGGCCAATAC
CTGCGCCTGACGCCGCACGGCGCCGATCTCGCTACCTTCGTCGAATGGGTACGCGCGTTCGTCGGCCACG
AGTACGCGTGGGAGGTCAAGCTGCTGATAAAGCCGTGCGAGGTGCCGCCCGCGCGCGCCGACACTTCGCA
GCGGCTCGGCTATTCAACATGGCTCGGCGAGCCGACGCACGATCGCCCCGTGGTCGGCATGGTGTTCGAG
CCGGAACAGTACACCGACTGA