SecReT6
Protein ID: 238023648
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01570
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]180568..182448 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDC5ALE4
KEGG IDbgl:bglu_2g01570
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-213, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|238023648|ref|YP_002907880.1| unnamed protein product [Burkholderia glumae BGR1]
MDPRFLDYYSRELTYLHELAGEFAAQHPKIARRLGMEGIEVADPYVERLIEAFCFMSARTQLKLDAEFPR
FTQRLLEVVYPNYVAPTPSIAVAQLRPSLREGDFTHGLTVPRHSPLRAAIPVGEQTACEFRSSQDITLWP
IEIAEARLTAVPPDIPDTDRHLLPHQQLRGALRLRLRTTGEVKFNQMTRFDRLPIYIGGDERIASHLFEL
IHAGSVASVVRKLGAARGEGYVVAKTPVAFEGLQTDQGLLPLPWNAFHGHNLLQEYFACRQRFYFFALTQ
LAPGLARVDDKEAEIVLLLDRLPEELATHVDASRFLLFCTPIVNLFPKRTDRIEINRAHTDFHLIADRTR
PLDYEIFSVSRVFGQKAETSQEVEFNPLYQTLHSDIGNHGRYFSVCREQRTLSANARKYGTRMPYTGTEV
YVSLVDQAEAPYADDIRYLSVEAWVTNRDLPCLIPRNGRDDLTMSDSVPIEGVRLVHPPSAPRAPYASGE
TAWRLIRQLSFNYMPLSDLDHGDGGQALRNMLRLFIAPDEREQARQIEALVGARTEPVVRRLPGQDLLVY
GRGVRCALTLDETGFSGVSPYLFGLVLEHYLARHVSINVFTETELHSMQRGLVTRWRPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c182448-180568 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGATCCGCGCTTCCTCGACTACTACAGCCGCGAACTCACCTATCTGCACGAGCTGGCGGGCGAGTTCG
CCGCGCAGCATCCGAAGATCGCGCGCCGTCTCGGCATGGAGGGCATCGAGGTCGCCGATCCCTACGTCGA
GCGGCTGATCGAGGCCTTCTGCTTCATGTCGGCACGCACCCAGTTGAAGCTCGACGCAGAGTTTCCCCGC
TTCACGCAGCGCCTGCTCGAAGTCGTCTACCCGAACTACGTCGCACCGACACCGTCGATCGCCGTGGCGC
AGTTGCGGCCGAGCCTGCGCGAGGGCGATTTCACGCATGGCCTGACGGTGCCGCGCCACAGCCCGCTGCG
CGCAGCGATCCCGGTCGGCGAGCAAACAGCCTGCGAATTCCGCAGCAGCCAGGACATCACGCTGTGGCCG
ATCGAAATCGCCGAGGCCCGCCTCACGGCCGTGCCGCCCGACATCCCCGACACCGACCGCCATCTGCTGC
CGCATCAGCAGTTGCGCGGCGCGCTGCGACTGCGGCTGCGCACCACCGGCGAAGTCAAGTTCAATCAAAT
GACGCGGTTCGACCGGTTGCCGATCTATATCGGCGGCGACGAGCGGATCGCCTCGCACCTGTTCGAGTTG
ATTCATGCCGGCAGCGTCGCATCGGTGGTCCGCAAGTTAGGCGCGGCGCGCGGCGAGGGGTATGTGGTAG
CGAAAACCCCGGTGGCGTTCGAGGGTCTGCAGACCGATCAGGGCTTGTTGCCATTGCCGTGGAACGCCTT
CCACGGCCACAACCTGCTGCAGGAATACTTCGCCTGCCGCCAGCGTTTCTATTTCTTCGCGCTCACGCAG
CTCGCGCCCGGACTCGCGCGCGTGGACGACAAGGAGGCCGAGATCGTCCTGCTGCTCGACCGGCTGCCGG
AGGAACTCGCCACCCACGTGGACGCCTCGCGGTTCCTGCTGTTCTGCACACCCATCGTCAACCTGTTCCC
CAAGCGCACCGATCGAATCGAGATCAACCGTGCGCACACCGATTTCCATCTGATCGCCGATCGCACCCGG
CCTCTCGACTATGAGATCTTCTCAGTATCGCGCGTATTCGGCCAAAAGGCCGAGACCTCGCAGGAAGTCG
AGTTCAACCCGCTGTACCAAACGCTGCACAGCGACATCGGCAACCATGGGCGCTATTTTTCGGTGTGCCG
CGAGCAGCGCACGCTGTCGGCGAATGCGCGCAAATACGGCACCCGCATGCCATACACCGGCACCGAGGTC
TACGTGTCACTGGTCGACCAGGCGGAGGCGCCGTACGCCGACGATATCCGTTACCTGTCGGTCGAGGCCT
GGGTCACCAATCGCGACCTGCCGTGCCTCATTCCTCGCAACGGCCGCGACGACCTGACGATGTCGGACTC
GGTGCCGATCGAAGGCGTGCGCCTCGTGCATCCGCCGAGCGCGCCGCGCGCCCCGTACGCAAGCGGCGAG
ACGGCGTGGCGACTGATCCGCCAGCTGAGCTTCAACTATATGCCGCTCTCCGACCTCGACCACGGCGACG
GCGGGCAGGCGCTGCGCAACATGCTGCGCCTCTTCATCGCGCCGGACGAACGCGAGCAGGCACGTCAGAT
CGAGGCGCTGGTGGGGGCGCGCACCGAGCCGGTGGTGCGGCGCCTGCCGGGCCAGGATTTGCTGGTCTAC
GGGCGCGGCGTGCGCTGCGCGCTGACGCTCGACGAGACCGGCTTCTCGGGCGTGAGCCCTTATCTCTTCG
GGCTCGTGCTCGAGCATTACCTCGCGCGGCACGTATCGATCAACGTGTTCACCGAGACCGAGCTGCATTC
GATGCAACGCGGCCTCGTGACGCGCTGGCGACCGCGCATGGGCGGCCGAGGCGCCGTATGA