SecReT6
Protein ID: 238023649
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01580
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]182450..182968 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC5ALE5
KEGG IDbgl:bglu_2g01580
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-19, Aligned region: 41..148
Protein Sequence: 172 a.a.     [Download]
>gi|238023649|ref|YP_002907881.1| unnamed protein product [Burkholderia glumae BGR1]
MSLGTTRHRQACMPSLLDRLLDDAPGRPSERPEDYAPDAKGMLAIIRRDLGLLLNTTNFEDEPDVMRHPA
VAASVVNYGLPALSGGYLPHRNWEDVERRIRTAIVRFEPRLIPESLRLRPLHDTDPVRYNCLAFEIEALV
HWSPYPLELRIQSALDMERNQVTFEQATHAGH
 
Nucleotide Sequence: 519 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c182968-182450 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGCCTCGGTACCACCCGCCACCGGCAGGCCTGCATGCCGTCGCTGCTCGATCGCCTGCTCGACGACG
CGCCCGGGCGGCCCAGCGAGCGCCCGGAAGACTACGCGCCCGACGCAAAGGGCATGCTCGCCATCATCCG
GCGAGATCTCGGCCTGCTGCTCAACACCACTAATTTCGAGGACGAGCCCGATGTCATGCGGCATCCGGCG
GTAGCGGCCTCGGTCGTCAACTACGGCTTGCCGGCGCTATCAGGCGGCTATCTGCCGCATCGCAACTGGG
AAGACGTCGAGCGACGGATCCGCACCGCGATCGTGCGTTTCGAACCGCGCCTGATCCCGGAATCGCTGCG
GCTGCGCCCGCTCCACGACACGGATCCGGTCCGCTACAACTGCCTGGCGTTTGAAATCGAGGCGCTCGTG
CACTGGTCGCCCTATCCGCTCGAACTGCGCATCCAGAGCGCACTGGATATGGAAAGAAACCAGGTCACCT
TCGAACAAGCCACGCACGCGGGGCACTGA