SecReT6
Protein ID: 238023650
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01590
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]182965..183798 [-]
ProductVirulence protein, SciE type
NoteTagJ
UniProt IDC5ALE6
KEGG IDbgl:bglu_2g01590
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-42, Aligned region: 152..271
Protein Sequence: 277 a.a.     [Download]
>gi|238023650|ref|YP_002907882.1| unnamed protein product [Burkholderia glumae BGR1]
MTTNTDLPGSGAPSHARLDADTFDALKSRTEDHVRRCPADSRERWLLFELLCLDGAWERALRHLQTWATL
RPDGESRAQTFRLLVQSEAFRAEVFAGRRLPCSLGPVPAWLDTLHRANAALADQDLATADALRTVALNDA
PARGGDGQPLGAFAWLTDSDSRLGPVCELIATGCYHLLPFDDLSSLTLGPVTAPSDLIWRQATVTRNDGK
VLHGYVPMRYPGSERGPTPVKLARHTTWTELGETSVIALGQKTWTTDHGDFGLLGLDTCRFDTRERA
 
Nucleotide Sequence: 834 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c183798-182965 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGACGACAAACACTGACCTTCCCGGTTCGGGTGCTCCGAGCCACGCCCGCCTCGACGCCGATACGTTCG
ACGCACTGAAATCCCGAACCGAGGATCACGTGCGCCGCTGCCCCGCCGATTCGCGCGAGCGCTGGCTGCT
GTTCGAACTGCTGTGCCTCGACGGTGCCTGGGAGCGCGCGCTGCGCCATCTGCAGACCTGGGCGACGCTG
CGGCCCGACGGCGAATCGCGCGCGCAGACGTTTCGCCTGCTGGTGCAAAGCGAGGCGTTCCGTGCCGAGG
TATTCGCCGGACGCCGCTTGCCTTGCTCGCTCGGTCCAGTACCGGCCTGGCTGGATACGCTGCACCGCGC
CAATGCCGCGCTCGCGGACCAGGACCTCGCCACGGCCGACGCGTTGCGCACGGTCGCACTGAACGACGCG
CCGGCCCGCGGCGGCGACGGCCAGCCGCTCGGTGCGTTCGCCTGGCTTACCGACAGCGACAGCCGGCTCG
GGCCGGTTTGCGAACTGATCGCCACCGGCTGCTACCACTTGCTGCCGTTCGACGACCTCTCCTCGCTCAC
GCTCGGGCCAGTCACGGCGCCATCGGATCTGATCTGGCGCCAGGCGACAGTGACGCGAAACGATGGCAAG
GTGCTGCACGGCTATGTCCCAATGCGTTACCCGGGCTCGGAGCGCGGCCCGACTCCGGTCAAACTCGCGC
GACACACCACCTGGACGGAACTCGGCGAAACCAGCGTGATCGCGCTCGGGCAAAAGACCTGGACCACGGA
CCACGGCGATTTCGGCCTGCTCGGCCTCGATACCTGCCGCTTCGACACGCGGGAGCGCGCATGA