SecReT6
Protein ID: 238023652
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01610
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]185284..188085 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5ALE8
KEGG IDbgl:bglu_2g01610
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-36, Aligned region: 231..309
AAA_2 [PF07724], Evalue: 2.00E-36, Aligned region: 644..810
AAA [PF00004], Evalue: 6.40E-21, Aligned region: 232..364
AAA [PF00004], Evalue: 6.40E-21, Aligned region: 649..733
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 816..891
AAA_5 [PF07728], Evalue: 3.00E-13, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 3.00E-13, Aligned region: 377..402
AAA_5 [PF07728], Evalue: 3.00E-13, Aligned region: 648..762
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 36..76
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 361..400
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 492..564
AAA_16 [PF13191], Evalue: 4.30E-11, Aligned region: 617..691
Sigma54_activat [PF00158], Evalue: 8.50E-08, Aligned region: 228..250
Sigma54_activat [PF00158], Evalue: 8.50E-08, Aligned region: 620..747
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 374..401
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 646..671
AAA_22 [PF13401], Evalue: 1.60E-07, Aligned region: 710..728
AAA_19 [PF13245], Evalue: 8.80E-07, Aligned region: 230..256
AAA_19 [PF13245], Evalue: 8.80E-07, Aligned region: 604..617
AAA_19 [PF13245], Evalue: 8.80E-07, Aligned region: 646..670
AAA_25 [PF13481], Evalue: 4.10E-06, Aligned region: 232..271
AAA_25 [PF13481], Evalue: 4.10E-06, Aligned region: 644..674
AAA_29 [PF13555], Evalue: 8.00E-06, Aligned region: 224..249
AAA_29 [PF13555], Evalue: 8.00E-06, Aligned region: 645..673
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 226..292
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 648..668
IstB_IS21 [PF01695], Evalue: 8.60E-06, Aligned region: 720..782
AAA_14 [PF13173], Evalue: 1.40E-05, Aligned region: 232..313
AAA_14 [PF13173], Evalue: 1.40E-05, Aligned region: 647..730
AAA_17 [PF13207], Evalue: 2.40E-05, Aligned region: 31..80
AAA_17 [PF13207], Evalue: 2.40E-05, Aligned region: 233..250
AAA_17 [PF13207], Evalue: 2.40E-05, Aligned region: 647..686
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 232..260
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 648..675
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 232..293
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 649..680
T2SE [PF00437], Evalue: 0.0011, Aligned region: 223..248
T2SE [PF00437], Evalue: 0.0011, Aligned region: 632..726
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 647..688
UPF0079 [PF02367], Evalue: 0.0023, Aligned region: 232..252
UPF0079 [PF02367], Evalue: 0.0023, Aligned region: 639..674
Hpr_kinase_C [PF07475], Evalue: 0.0038, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0038, Aligned region: 646..666
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 232..252
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 648..669
AAA_23 [PF13476], Evalue: 0.006, Aligned region: 232..252
AAA_23 [PF13476], Evalue: 0.006, Aligned region: 646..676
TIP49 [PF06068], Evalue: 0.0075, Aligned region: 232..253
TIP49 [PF06068], Evalue: 0.0075, Aligned region: 280..312
TIP49 [PF06068], Evalue: 0.0075, Aligned region: 647..683
Protein Sequence: 933 a.a.     [Download]
>gi|238023652|ref|YP_002907884.1| unnamed protein product [Burkholderia glumae BGR1]
MVISRHALFGKLGTTLFRSLESATTFSKLRGNPYVELVHWLHQLIALADGDLQRIVRHCEIDRARLDRDL
QDALAALPSGAGSLSDFSHHVDAAIERAWVLATLVFGEHRIRGAWLMAALIETPELRRVLLSCSREFGRI
PVDGLHEALPAWIAGSPEADDTPYDHSDFSPAVPGEASDAMAAPARGSSLEQFCADLTARALKGEIDPVV
GRDIEIRTMVDVLLRRRQNNPLLTGDAGVGKTAVVEGLALAIARGDVPPKLAEVRLLNLDVGALLAGASM
RGEFEARLKSVIEAAGKAPVPVILFIDEIHTLIGAGGQAGTGDAANLLKPALARGTLRVIGATTWAEYKR
HIEKDPALTRRFQVLQVAEPEPGAAVDMVRGLVGTFSRHHGVVVLDEAVRASVMLSHRYLPSRQLPDKAI
SLLDTACARVALSQHAPPRELQYLRQQLEAARIESALLDAERRVGIGDGASWSEVAQRIAELEVQARDIE
QAWQAQVEAVRALLEARAETEGEDERGGEPDGGAGQPCLPADPDTGPAERAVAPAAAHVDTAAFERLHLL
DRQLRQLQGGRPLVFPEVSEAMVAAIISDWTGIPVGRMVTDEIAAVRRLSETLSARVVGQTDALRQIAER
IQTARAGLADPAKPLGVFLLTGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSSLKGAPPGY
VGYGEGGVLTEAVRRRPYSVVLLDEIEKSHSDVKEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGAE
LLTSLCADEALAPESDALRMALGPVLLKAFPAAFLGRVTVVPFRPLAQGSLVQIARLYLDRVARRMADHH
GVELVYAPAVADYVVARCLVQETGARLMIGFIEQHLLPALSRHWLDALISNRRLARIEIEMASVDPDAAP
AEAIAFRLVDDGLPLDVSASAEG
 
Nucleotide Sequence: 2802 bp     [Download]
>gi|339717964|ref|NC_012721.2|:185284-188085 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGTCATTTCACGTCACGCGCTATTCGGCAAACTCGGCACGACGCTGTTCCGGAGCCTCGAATCTGCCA
CCACCTTCTCGAAACTGCGCGGCAATCCCTACGTCGAGCTGGTCCACTGGCTTCATCAATTGATCGCGCT
GGCCGACGGTGATCTGCAGCGCATCGTGCGGCACTGCGAGATCGATCGCGCGCGGCTCGATCGAGACTTG
CAGGATGCGTTGGCGGCTCTGCCGTCCGGTGCCGGCTCGCTGAGTGATTTCTCACATCACGTGGACGCGG
CGATCGAGCGCGCGTGGGTACTTGCGACGCTCGTGTTTGGCGAGCACCGAATTCGTGGCGCGTGGCTGAT
GGCCGCGTTGATTGAGACGCCCGAATTGCGGCGCGTATTGCTGTCCTGCTCGAGGGAGTTCGGCCGGATC
CCGGTGGACGGCCTGCACGAGGCGCTGCCGGCCTGGATCGCCGGGTCGCCCGAGGCCGACGACACGCCCT
ATGATCACAGCGATTTCTCGCCGGCGGTGCCGGGAGAGGCGTCCGATGCGATGGCGGCGCCGGCCCGCGG
CAGTTCGCTCGAGCAGTTCTGTGCCGATCTGACGGCGCGCGCGCTCAAGGGCGAAATCGATCCGGTGGTG
GGCCGGGATATCGAGATTCGCACGATGGTGGACGTGCTGCTGCGACGCCGGCAAAACAATCCATTGCTGA
CTGGCGATGCTGGCGTCGGCAAGACCGCCGTCGTCGAGGGGCTGGCGCTCGCGATCGCGCGCGGCGACGT
GCCACCCAAGCTTGCCGAGGTGCGGCTGCTGAACCTCGATGTTGGCGCGTTGCTGGCCGGCGCGAGTATG
CGCGGCGAGTTCGAGGCGCGCTTGAAATCGGTGATTGAGGCGGCGGGAAAGGCGCCCGTGCCGGTGATCC
TGTTTATCGACGAGATTCATACTTTGATCGGTGCGGGTGGCCAGGCCGGCACCGGAGATGCGGCGAACCT
GCTGAAGCCCGCGCTCGCGCGCGGCACGCTGCGCGTGATCGGCGCCACCACCTGGGCCGAATACAAGCGA
CATATCGAGAAGGATCCGGCGCTCACGCGTCGCTTCCAGGTGCTGCAGGTGGCCGAGCCGGAACCGGGCG
CCGCCGTCGACATGGTACGCGGGTTGGTTGGCACGTTCTCGCGGCACCATGGCGTTGTCGTGCTCGATGA
GGCCGTGCGCGCGTCCGTGATGCTGTCGCATCGCTATCTGCCGTCGCGTCAGTTGCCGGACAAGGCGATC
AGCCTGCTCGACACGGCTTGCGCGCGTGTTGCCTTGTCGCAGCACGCACCGCCGCGCGAATTACAGTATT
TGCGTCAGCAGCTCGAGGCGGCGCGTATCGAAAGCGCGCTGCTCGATGCCGAGCGGCGCGTCGGCATCGG
CGACGGCGCGTCGTGGTCCGAGGTGGCACAGCGCATCGCCGAACTCGAGGTACAAGCGCGTGATATCGAG
CAGGCATGGCAGGCTCAGGTGGAGGCGGTGCGAGCCCTGCTTGAGGCGCGTGCCGAGACGGAGGGCGAGG
ACGAGCGCGGCGGCGAACCGGACGGTGGCGCCGGCCAGCCCTGCCTCCCTGCCGATCCGGACACCGGGCC
CGCCGAGCGCGCTGTCGCGCCGGCGGCTGCTCACGTCGACACGGCGGCTTTCGAACGGTTGCACCTGCTG
GATCGTCAGCTGCGGCAGTTGCAGGGCGGGCGTCCGTTAGTGTTTCCGGAGGTGAGCGAGGCGATGGTGG
CCGCGATCATCTCCGATTGGACTGGCATCCCGGTCGGTCGCATGGTCACTGATGAAATCGCGGCGGTGCG
GCGTCTTTCCGAGACGCTTTCGGCACGGGTCGTGGGGCAGACGGACGCGTTGCGGCAGATTGCCGAACGC
ATACAGACTGCTCGCGCGGGCCTGGCCGATCCAGCCAAGCCGCTGGGCGTGTTCCTACTGACCGGGCCGT
CCGGCGTTGGCAAGACCGAGACGGCGCTCGCGCTCGCGGAAGCGCTGTATGGAGGGGAACAAAACCTTAT
TACCATCAACATGAGCGAGTATCAGGAAGCGCACACGGTATCGAGCCTGAAGGGCGCCCCACCGGGGTAC
GTCGGCTATGGGGAGGGGGGCGTCTTGACCGAGGCGGTGCGCCGTCGGCCCTATTCGGTCGTGCTGCTCG
ACGAGATCGAGAAATCGCATAGCGACGTAAAGGAGATGTTCTTCCAGGTATTCGACAAGGGCTACATGGA
AGACGGCGACGGCCGCTATATCGATTTTCGCAATACCACGATCCTGCTCACCAGCAACGTTGGCGCAGAG
CTGCTAACCAGCTTGTGCGCGGATGAGGCGCTGGCGCCCGAGTCCGACGCGCTGCGCATGGCGCTCGGTC
CGGTGTTGCTGAAGGCGTTTCCGGCCGCGTTCCTGGGACGCGTGACGGTGGTGCCATTCCGTCCGCTCGC
CCAGGGTTCGCTCGTGCAGATCGCCCGGTTGTATCTGGATCGGGTCGCTCGGCGCATGGCGGATCATCAT
GGCGTCGAGCTCGTTTATGCGCCGGCTGTCGCCGACTACGTCGTTGCGCGCTGCCTCGTGCAGGAGACAG
GCGCACGGCTGATGATCGGCTTTATCGAGCAGCATCTGCTGCCGGCGCTCTCCCGGCATTGGCTCGACGC
GCTCATCTCGAATCGGCGGCTCGCGCGCATCGAAATCGAAATGGCCTCGGTCGATCCCGATGCGGCACCC
GCCGAAGCGATTGCGTTTCGCCTGGTCGACGATGGTTTGCCGCTCGACGTTTCGGCAAGCGCCGAGGGGT
GA