SecReT6
Protein ID: 238023687
SecReT6 ID339
T6SS typei2
Gene symbol-
Locus tagbglu_2g02120
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]245401..245859 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC5ALI3
KEGG IDbgl:bglu_2g02120
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-48, Aligned region: 2..140
Protein Sequence: 152 a.a.     [Download]
>gi|238023687|ref|YP_002907919.1| unnamed protein product [Burkholderia glumae BGR1]
MHTGGARKKVELPLKLLVAGDFSAGREQAPLAERKKINIDKNNFDAVLADYAPDLKISAENTLAGDGSAL
PVNLSFRSMKDFEPEQVARQIPELQAMLAMRNLLRDLKSNLLDNGTFRREFEKILKDKHLSDKLRSELAQ
VATAATQPEGQA
 
Nucleotide Sequence: 459 bp     [Download]
>gi|339717964|ref|NC_012721.2|:245401-245859 Burkholderia glumae BGR1 chromosome 2, complete sequence
CTGCATACGGGCGGAGCCCGGAAGAAGGTCGAGCTGCCGCTCAAGCTGCTCGTCGCCGGCGACTTCAGCG
CGGGTCGGGAACAGGCGCCGCTGGCCGAACGCAAGAAGATCAATATCGACAAGAATAATTTCGATGCCGT
GCTTGCCGACTATGCCCCCGACCTGAAGATCTCCGCCGAGAACACGCTCGCGGGCGATGGTTCGGCGTTG
CCGGTGAACCTCTCGTTCCGGTCGATGAAAGACTTCGAGCCGGAGCAGGTGGCCCGGCAGATTCCGGAAC
TGCAGGCGATGCTGGCAATGCGCAATCTGCTGCGGGATCTGAAAAGCAACCTGCTCGACAACGGCACCTT
CAGGCGCGAGTTCGAGAAGATCCTGAAGGATAAGCATCTGTCTGACAAGCTGCGCAGCGAGCTCGCGCAG
GTCGCCACCGCAGCCACCCAACCGGAAGGTCAGGCCTGA