SecReT6
Protein ID: 238023688
SecReT6 ID339
T6SS typei2
Gene symbol-
Locus tagbglu_2g02130
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]245902..247434 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDC5ALI4
KEGG IDbgl:bglu_2g02130
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-177, Aligned region: 87..506
Protein Sequence: 510 a.a.     [Download]
>gi|238023688|ref|YP_002907920.1| unnamed protein product [Burkholderia glumae BGR1]
MKQNESRQGVNETVVLENDSVYASLCSKINLTPVAEARPLEAFRDNDMLSEASADERIARGMSAFLDLIA
QSSQPVERLDKSLLDFHIGQLDRQISRQLDAVMHTPAFQALEGRWRGLKLLVARTDFRKNAKIEVLDVSK
EALQRDFEDTPELIQSGLYRLTYIEEYDTPGGQPISAMISDFEFTNSPMDVALLRNISKVAAAAHMPFIG
SVGAAFFGKQSMEEVAAIQDIGNYFDRAEYIKWKSFRETDDARYVGLTMPRVLGRLPYGKDTTPVRAFNY
EEAVKGPDHDRYLWVNASFAFAANMVRSFVNNGWCVQIRGPQAGGKVEDLPVHLYDLGTGVQPKIPTEVL
IPETREFEFANLGFIPLSFYKNHDFACFFSASSTQKPALYETKEATANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTKDRRLLELELNNWIKGLVTEMKDPDDELQASHPLRDAKVTVEDIDDNPGFFRIKLFIIPHF
QVEGMDIGLSLVSQMPKAKS
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|339717964|ref|NC_012721.2|:245902-247434 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAAGCAGAATGAATCCCGTCAGGGTGTGAACGAAACCGTCGTGCTGGAAAACGACAGCGTGTATGCCT
CGCTCTGCAGCAAGATCAACCTCACGCCGGTCGCCGAGGCGCGTCCGCTCGAGGCCTTCCGCGACAACGA
CATGCTCTCCGAAGCGTCAGCCGACGAGCGTATCGCGCGCGGCATGAGCGCCTTCCTGGATCTGATCGCG
CAGTCGAGCCAGCCGGTCGAGCGCCTCGACAAATCGCTGCTGGACTTCCATATCGGCCAGCTCGACCGCC
AGATCAGCCGCCAGCTCGACGCCGTGATGCACACGCCGGCGTTCCAGGCGCTCGAGGGGCGCTGGCGCGG
TCTCAAGTTGCTCGTCGCGCGCACGGACTTTCGCAAGAACGCGAAGATCGAGGTGCTCGACGTGTCGAAG
GAGGCGCTGCAGCGCGACTTCGAGGACACGCCGGAACTGATCCAGAGCGGCCTGTATCGCCTCACCTACA
TCGAGGAGTACGACACGCCGGGCGGCCAGCCGATCAGCGCGATGATCAGCGACTTCGAGTTCACGAACTC
GCCGATGGACGTGGCGCTGCTGCGTAACATCTCGAAGGTGGCGGCGGCGGCCCACATGCCGTTCATCGGC
TCGGTGGGCGCAGCATTCTTCGGCAAGCAGTCGATGGAAGAGGTGGCGGCCATTCAGGACATCGGCAACT
ACTTCGACCGCGCCGAGTACATCAAATGGAAGAGCTTCCGTGAAACCGATGACGCCCGTTATGTCGGCCT
GACGATGCCGCGCGTGCTCGGCCGCCTGCCGTATGGCAAGGACACCACGCCGGTGCGTGCCTTCAATTAC
GAGGAGGCGGTGAAGGGCCCGGACCACGACCGGTACCTGTGGGTCAACGCGTCGTTCGCGTTCGCGGCCA
ATATGGTGCGCAGCTTCGTGAACAACGGCTGGTGCGTGCAGATTCGCGGCCCGCAGGCGGGCGGCAAGGT
GGAGGACCTGCCGGTGCATCTGTATGACCTGGGCACCGGCGTGCAGCCGAAGATCCCGACCGAGGTGCTG
ATCCCCGAGACACGCGAGTTCGAGTTCGCGAATCTCGGCTTCATCCCGCTGTCGTTCTACAAGAACCACG
ACTTCGCGTGCTTCTTCTCGGCCAGCTCGACGCAGAAGCCGGCGTTGTACGAGACCAAGGAGGCGACGGC
CAACAGCCGCATCAACGCGCGCCTGCCTTACATCTTCCTGCTGTCGCGCATCGCGCATTACCTGAAGCTG
ATCCAGCGCGAGAACATCGGCACGACCAAGGACCGGCGTCTGCTCGAGCTCGAGCTGAACAACTGGATCA
AGGGGCTCGTGACCGAGATGAAGGATCCGGACGACGAACTGCAGGCCTCGCATCCGCTGCGCGACGCGAA
GGTCACGGTCGAGGACATCGATGACAACCCGGGCTTCTTCCGCATCAAGCTCTTCATCATTCCGCACTTC
CAGGTGGAGGGGATGGACATCGGCCTGTCGCTGGTTTCGCAGATGCCCAAGGCCAAGAGTTAA