SecReT6
Protein ID: 238023689
SecReT6 ID339
T6SS typei2
Gene symbol-
Locus tagbglu_2g02140
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]247532..249883 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC5ALI5
KEGG IDbgl:bglu_2g02140
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-55, Aligned region: 30..350
Phage_GPD [PF05954], Evalue: 3.80E-55, Aligned region: 562..595
DUF2345 [PF10106], Evalue: 9.90E-44, Aligned region: 530..575
DUF2345 [PF10106], Evalue: 9.90E-44, Aligned region: 603..751
T6SS_Vgr [PF13296], Evalue: 2.20E-29, Aligned region: 335..351
T6SS_Vgr [PF13296], Evalue: 2.20E-29, Aligned region: 480..584
T6SS_Vgr [PF13296], Evalue: 2.20E-29, Aligned region: 621..643
Phage_base_V [PF04717], Evalue: 2.90E-11, Aligned region: 109..146
Phage_base_V [PF04717], Evalue: 2.90E-11, Aligned region: 415..474
Sarcoglycan_1 [PF04790], Evalue: 0.00025, Aligned region: 627..709
Sarcoglycan_1 [PF04790], Evalue: 0.00025, Aligned region: 718..741
Protein Sequence: 783 a.a.     [Download]
>gi|238023689|ref|YP_002907921.1| unnamed protein product [Burkholderia glumae BGR1]
MSSILPTQAYELKLAPHPAPFSVLEFSGRDAVSELYHYDIEFTSPAAGIPMEQVVGRPARFTIAPIDPNM
GYLRKMFGENAEQFSKMPPAHTIHGIITEFDEFATTADQTHYRVRLEPVLADLHRGVTSRLFQKQSIEEI
VTDTLRHYGYRVGVDFVFQLRHQYKRHEYVTQYHETTFAFIQRLCAQEGIWFRWEQKKDHAVIVFGDDLD
AYARKQRTVPYLRDAGLESSGADTIKTLEKRTRRVPEAVRLHDYNHREAGVSLLVEENAARADKSTNGVD
YRWGEHYETPEEGRQIARRRHEAYLANQITFKGTGNPFWLEAGEVMRVEPVQADAKHGIFITAVESSGGR
SQSYWVSFEGIPSDRAYRTPIASIKRPAIDGILPARITSPGNYKYAYLTEQGWYVIKLPFDLDEWSPGGT
SRPVRFAKPYSGDSYGHHFPLIDGAEVAIVFTDGNPDRPVIIGAMHDSLHPDLVNNLNHTRNIVRTAAQN
ELRMEDKENVEHIHLTTPFQTSELNLGHMVDGDRKERGQGAELRTDGHLTARGPRGMLLTTEAQTGASGH
QLDMKGAQEQLQRAIERMESLTQAVQAAEATVAELQKQKALYTEALDGLKRAAILVSAPSGIGLTSGEHL
QVNADQNLIATAGGNFDVGTMRNFTVAAGRQVALFAQAQGMRLIAAKQDVIMQARTGAMALSASKDLHFN
SVDGSIVAASRGALTLTSRGAYIKIDGGNIELGCPGDITLKCGNFHWTGPGNLSVPLPAMPIGPCKECLL
DAHRGVEAMTEVA
 
Nucleotide Sequence: 2352 bp     [Download]
>gi|339717964|ref|NC_012721.2|:247532-249883 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGTCGTCGATCCTGCCTACCCAGGCCTACGAGTTGAAGCTCGCACCGCATCCGGCGCCGTTCTCGGTGC
TCGAGTTCAGCGGCCGGGACGCCGTGAGCGAGCTGTATCACTACGACATCGAGTTCACCAGCCCGGCAGC
GGGCATCCCGATGGAGCAGGTGGTCGGCCGGCCCGCGAGATTCACCATCGCTCCGATTGACCCGAACATG
GGCTACCTGCGCAAGATGTTCGGTGAGAACGCGGAGCAGTTCAGCAAGATGCCGCCCGCGCACACCATCC
ACGGCATCATCACGGAATTCGATGAATTCGCCACGACGGCCGACCAGACGCACTACCGGGTGCGGCTCGA
GCCGGTGCTCGCCGACCTGCACCGGGGCGTGACGAGCCGGCTGTTCCAGAAGCAGTCGATCGAGGAAATC
GTGACCGACACGCTGCGCCATTACGGCTACCGCGTCGGCGTCGACTTCGTGTTCCAACTGCGCCACCAGT
ACAAGCGGCACGAATACGTGACGCAGTACCACGAGACCACGTTTGCCTTCATCCAGCGCCTCTGTGCGCA
GGAGGGCATCTGGTTCCGCTGGGAGCAGAAGAAGGATCACGCGGTGATCGTGTTCGGCGACGATCTCGAT
GCCTATGCACGCAAACAGCGCACGGTGCCTTACCTGCGAGACGCCGGACTCGAGAGCTCAGGCGCGGACA
CGATCAAGACGCTAGAAAAGCGGACCCGGCGCGTACCCGAAGCCGTGCGGTTGCACGACTACAACCATCG
CGAGGCGGGCGTATCGCTGCTCGTCGAGGAAAACGCCGCGCGTGCCGACAAGTCGACGAACGGTGTCGAC
TACCGCTGGGGCGAGCATTACGAAACGCCGGAGGAGGGCAGGCAGATCGCCCGCCGGCGCCATGAGGCGT
ATCTGGCGAACCAGATCACCTTCAAGGGCACCGGCAATCCGTTCTGGCTGGAGGCGGGCGAAGTCATGCG
TGTCGAGCCGGTCCAGGCCGACGCGAAGCACGGGATCTTCATCACCGCGGTGGAATCGAGCGGCGGCCGT
AGCCAATCGTACTGGGTGAGCTTCGAGGGGATTCCGTCCGATCGCGCGTATCGAACGCCGATCGCCTCGA
TCAAGCGACCGGCCATTGACGGCATCCTGCCGGCCCGCATTACATCGCCGGGCAACTACAAATACGCGTA
CCTGACCGAGCAGGGCTGGTATGTGATCAAGCTGCCGTTCGATCTCGACGAGTGGAGTCCGGGCGGTACG
AGCCGGCCGGTGCGGTTTGCCAAGCCGTACAGTGGGGACAGCTACGGGCACCACTTCCCGCTGATCGACG
GGGCGGAAGTCGCCATCGTCTTTACCGATGGCAATCCGGACCGGCCCGTGATCATCGGGGCCATGCACGA
CAGCCTGCATCCGGATCTCGTCAATAACCTCAATCACACCCGCAACATCGTTCGCACCGCCGCACAGAAC
GAGCTGCGGATGGAGGATAAGGAAAACGTCGAGCACATCCACCTGACGACGCCGTTCCAGACCAGTGAGC
TCAATCTCGGGCACATGGTCGATGGGGACCGCAAGGAACGCGGACAGGGGGCTGAATTGCGTACCGACGG
GCATCTGACGGCACGCGGGCCGCGGGGTATGCTGCTGACCACCGAAGCTCAGACCGGTGCATCGGGACAT
CAGCTCGACATGAAAGGAGCCCAGGAGCAGTTGCAGCGGGCGATCGAACGTATGGAGTCCCTGACCCAGG
CGGTCCAGGCGGCGGAAGCCACGGTAGCCGAACTGCAGAAGCAGAAAGCGCTCTATACGGAAGCGCTTGA
TGGCCTGAAGCGGGCAGCCATTCTCGTGAGCGCTCCATCGGGCATCGGACTCACGTCAGGTGAGCATCTG
CAGGTCAACGCTGACCAGAACCTCATCGCCACTGCGGGCGGAAACTTCGATGTCGGGACCATGCGGAATT
TTACTGTGGCGGCTGGTCGCCAGGTAGCGCTTTTCGCGCAGGCGCAAGGTATGAGACTCATTGCCGCAAA
GCAGGACGTGATCATGCAAGCCCGCACTGGCGCCATGGCGCTGTCTGCATCGAAGGACCTGCATTTCAAC
AGCGTTGACGGATCGATCGTCGCAGCGTCCCGCGGTGCATTGACGCTGACCAGTCGTGGAGCCTACATCA
AGATTGACGGAGGCAACATCGAACTGGGCTGCCCCGGCGACATCACGCTCAAGTGTGGGAACTTTCACTG
GACCGGACCGGGCAATCTGTCCGTTCCCCTACCGGCAATGCCGATCGGGCCGTGCAAGGAATGCCTGCTG
GACGCTCACCGCGGTGTCGAAGCGATGACGGAGGTCGCATGA