SecReT6
Protein ID: 238024040
SecReT6 ID340
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g05960
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]717236..719599 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC5AMI6
KEGG IDbgl:bglu_2g05960
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.80E-55, Aligned region: 41..360
DUF2345 [PF10106], Evalue: 2.90E-44, Aligned region: 51..65
DUF2345 [PF10106], Evalue: 2.90E-44, Aligned region: 616..763
T6SS_Vgr [PF13296], Evalue: 1.20E-26, Aligned region: 495..597
Phage_base_V [PF04717], Evalue: 0.00026, Aligned region: 100..123
Phage_base_V [PF04717], Evalue: 0.00026, Aligned region: 413..479
Protein Sequence: 787 a.a.     [Download]
>gi|238024040|ref|YP_002908272.1| unnamed protein product [Burkholderia glumae BGR1]
MATMQTLQDVLKHPSAIVTQPLHLEIATLRSPISVFSFVLTEEMNTPFVADITVTSKDKHIDGAAVIGRP
AIFSIEEHASVPSLPGLINPVQQATRTVHGIVTQWTRVKTSRDEATYQLHLKPRLALLEQVHDSAVFLDR
SFRELLTDTIVDRDLFQSYDVEFELDGLDAKLHQTVMYEETIANFIDRHCRRAGVFYYFKHAKKEDGPQR
DTLVFSNTARGYMRALEVPLLPNSGLVSWHEAILELNVTRSLVPQTVREWDHNYRQPDGPLQVESVVAEK
GDRSVYGSVNCSIEHFHSAEEGQVLADARRDELITRQTRISGKSNVMGMMPGMVVRVINDTVPEAPHGIV
ITKLVTTGSRKQSVTNQFEAIPSHLTYRPEYVPEKHWRWIGGALIGIVESGDDQPYAWMDEYGGYRVRLL
FTRHTGKRGTNSMSLRLLRTSASYQGGLHVPLLPNTEVRVIATHGNCDRLLIAGAAHDYARRDLVHGKEG
WYSRAVFRSPLLGNKLRFEDLKSHEGIRLATVFGKTALNMGYLVDGEKNKRGEGYELTTQGWGVTRAAKG
LFWSADPVNPTAPHLEMQAAIKQLQAAIQRVTALANATAQARATPADKTTQSSLMDVLDQLKNAGLLASA
PAGMAFVTSKSIQQAAGENVIVTAGQHADVSVLKRFTVAAGELISLCAHKLGLKIFATHGKVEIQSQSDA
MELAAAKQLKLASADEDVLVVARKKIVLASGGAALKIEDGTFEFISPGAFKIKAGSFVFQGPGNVNPPLP
VLPKSNLNSPDDYSLSH
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|339717964|ref|NC_012721.2|:717236-719599 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGCGACCATGCAAACTCTCCAGGATGTGCTCAAGCACCCAAGCGCGATCGTCACCCAGCCTCTCCATC
TCGAGATAGCGACGCTGCGGTCACCGATATCGGTGTTTTCGTTTGTCCTCACGGAAGAAATGAACACACC
GTTTGTCGCGGACATCACCGTTACGTCGAAGGACAAGCACATTGACGGCGCGGCCGTGATCGGGCGCCCG
GCCATCTTCTCGATCGAGGAACACGCGTCGGTGCCGTCGTTGCCCGGTCTGATCAACCCGGTCCAGCAGG
CGACACGCACTGTGCACGGCATTGTGACGCAGTGGACGCGGGTCAAGACGTCGCGCGACGAGGCGACCTA
CCAGCTGCATCTCAAGCCGCGACTCGCACTGCTCGAGCAGGTACATGATTCGGCCGTATTCCTGGACCGC
TCGTTTCGCGAGCTGCTCACCGACACGATTGTCGATCGCGACCTGTTCCAGTCTTATGACGTCGAGTTCG
AACTGGACGGGCTCGACGCGAAACTGCACCAAACCGTCATGTACGAGGAGACGATCGCGAATTTCATCGA
CAGGCATTGCAGGCGCGCTGGCGTCTTCTACTACTTCAAACATGCGAAGAAGGAAGACGGACCGCAGCGC
GACACGCTGGTGTTCAGCAATACCGCGCGCGGCTACATGCGGGCGCTCGAGGTGCCGCTGCTGCCGAATT
CGGGTCTCGTCAGCTGGCACGAGGCCATTCTTGAGCTGAACGTGACGCGCTCGCTCGTGCCGCAGACCGT
GCGTGAATGGGACCACAACTACCGGCAGCCGGACGGTCCGTTGCAGGTCGAATCGGTCGTGGCCGAGAAG
GGGGACCGCTCGGTGTACGGCAGCGTCAACTGTAGCATCGAGCATTTCCACTCCGCCGAGGAGGGACAGG
TGCTTGCCGATGCACGACGCGACGAGCTGATCACGCGTCAGACACGGATCTCGGGCAAGAGCAACGTGAT
GGGCATGATGCCGGGCATGGTGGTGCGGGTGATCAACGACACCGTGCCCGAAGCGCCACACGGCATCGTG
ATCACCAAGCTCGTTACGACGGGTAGCCGCAAGCAGTCGGTGACCAATCAGTTCGAGGCGATCCCGTCGC
ATCTGACCTACCGGCCCGAGTATGTACCGGAAAAGCATTGGCGCTGGATAGGCGGTGCACTTATCGGCAT
CGTGGAATCCGGCGACGACCAGCCGTATGCATGGATGGACGAGTATGGCGGTTACCGGGTGAGGCTTCTC
TTCACACGGCACACCGGCAAGCGCGGCACGAACAGTATGTCGTTGCGCCTACTGCGTACGTCGGCCTCGT
ATCAGGGTGGTCTGCACGTCCCATTGCTGCCGAACACGGAAGTCCGCGTCATTGCGACCCACGGCAATTG
CGATCGGTTACTGATCGCCGGTGCCGCCCATGACTATGCGCGGCGGGATCTAGTACATGGCAAGGAGGGC
TGGTACAGCCGTGCGGTGTTCCGCTCGCCGCTGCTGGGCAACAAGCTGCGCTTCGAGGACTTGAAGAGCC
ACGAGGGCATTCGGCTTGCAACGGTCTTCGGCAAGACGGCGCTCAATATGGGCTATCTCGTTGACGGCGA
GAAGAACAAGCGCGGCGAAGGCTACGAGCTCACCACGCAAGGTTGGGGCGTAACGCGCGCGGCAAAGGGG
TTGTTCTGGTCGGCAGACCCCGTAAACCCGACCGCTCCGCATCTCGAAATGCAGGCGGCGATCAAGCAGC
TGCAAGCCGCTATTCAGCGCGTGACCGCGCTGGCCAATGCGACCGCGCAGGCACGTGCCACCCCGGCCGA
CAAGACGACGCAATCGAGTCTGATGGACGTGCTCGACCAGTTGAAGAACGCCGGACTGCTTGCCAGCGCA
CCGGCCGGCATGGCGTTCGTCACATCGAAGTCGATCCAGCAGGCGGCCGGCGAGAACGTGATCGTGACGG
CTGGCCAGCACGCGGACGTGAGCGTGCTCAAGCGGTTTACCGTAGCGGCCGGCGAGCTCATCTCGCTGTG
CGCACATAAGCTCGGCCTGAAAATCTTTGCCACGCATGGCAAGGTCGAAATCCAGTCGCAGAGCGATGCG
ATGGAGCTGGCTGCGGCAAAACAGCTGAAGCTGGCAAGCGCGGACGAGGACGTGCTGGTGGTTGCGCGCA
AGAAGATCGTGCTGGCCAGCGGCGGCGCCGCACTCAAGATCGAAGACGGCACATTCGAATTCATCAGCCC
GGGAGCCTTCAAGATCAAGGCCGGCTCGTTCGTGTTCCAGGGTCCTGGTAATGTCAATCCGCCATTGCCC
GTGCTGCCCAAAAGTAATCTGAATTCCCCCGACGACTACTCGCTTTCGCACTGA