SecReT6
Protein ID: 238024042
SecReT6 ID340
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g05980
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]722612..722872 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDC5AMI8
KEGG IDbgl:bglu_2g05980
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.20E-18, Aligned region: 6..79
Protein Sequence: 86 a.a.     [Download]
>gi|238024042|ref|YP_002908274.1| unnamed protein product [Burkholderia glumae BGR1]
MNSPIRKDDELEHGGRVTGGSSTMEFMGRPLARKSDAAHCDLHGETVSDEGDESFPDQDGKPVAMHLHRC
ACGCRLISSLQNVHIG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|339717964|ref|NC_012721.2|:722612-722872 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAATTCCCCCATTCGCAAAGACGATGAACTGGAGCACGGCGGCCGGGTCACGGGTGGTTCTTCGACCA
TGGAGTTCATGGGCCGACCGCTGGCGCGCAAGAGCGATGCCGCGCACTGCGACCTGCACGGCGAAACCGT
GAGCGATGAAGGCGACGAATCGTTTCCTGACCAAGACGGCAAACCCGTGGCGATGCATCTGCATCGCTGT
GCGTGCGGCTGCCGGTTGATCTCGTCGCTGCAAAACGTACACATCGGCTGA