SecReT6
Protein ID: 238024045
SecReT6 ID340
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g06010
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]727915..729675 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC5AMJ1
KEGG IDbgl:bglu_2g06010
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-121, Aligned region: 1..578
Protein Sequence: 586 a.a.     [Download]
>gi|238024045|ref|YP_002908277.1| unnamed protein product [Burkholderia glumae BGR1]
MRYLREAGREFAEAQPQAARQLGMTTPGAPDDRVAAVYEGFAFLTSRLRMKLDDALPEITDPLIDHLWPH
AGRTIPSLAILECKPRTGEARILDILPAGLQVRSTPIGSDGTVCVYRTTQPVRLLPLEVCEAGVRMREDG
RTVIRLAFNLLHREQRLLDDLSRIRLYLHGDRPTASALYAVLTQQVESIGMRMPRLLDCQLQPQPAMRFE
AAGFGPDTRLWPVDRDARDAELDREQTMLEYFAFPEKFHFVDLCGFNTAGVPPGETRIEFEIVLNGRIAG
DVTFGANNIRLFCTPVINLFELDAQAIRPNAHDRDYPVRPPASAGDHIEPYDAQSVVAADPRNAMYHEYQ
SFKEFRHRGGMMRYESPERYYHSSIRHGVTGQREMWVTLGGHLWDEPGSVPDGHVTVRVLANNGRLPRMA
LSESMITEPVSAFSGVERVRNLTAPTMPLYPPRGGEYDWKVVSHFNAAGSTELNMMDASVLRGALSLYDW
SPQDDNMRRIEAIHYVWLDEDTEIIGTRVDRIVNVNVGIEPSGFAGPGDVALFGDVLSRFVGRYACFHYA
VRLVLYQGVGGAVRRYPPVLKTGDWL
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|339717964|ref|NC_012721.2|:727915-729675 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCGCTACCTGCGCGAAGCGGGCAGAGAATTCGCCGAAGCGCAGCCGCAGGCCGCGCGGCAGTTGGGGA
TGACAACACCCGGCGCGCCGGACGATCGCGTCGCAGCGGTCTACGAGGGCTTCGCATTCCTGACGAGCCG
GCTGCGCATGAAACTCGATGACGCGCTGCCGGAAATCACCGACCCGTTGATCGATCACCTGTGGCCACAT
GCAGGCCGCACCATCCCGTCGTTGGCGATTCTCGAGTGCAAGCCTCGCACGGGCGAAGCACGGATTCTGG
ACATCCTGCCAGCAGGCCTGCAGGTGCGCTCGACGCCGATCGGCTCCGACGGCACGGTATGCGTTTATCG
CACCACCCAACCGGTGCGTCTGCTGCCGCTCGAAGTCTGTGAGGCAGGCGTGCGGATGCGCGAGGACGGC
CGCACGGTGATCCGGCTCGCGTTCAATCTGCTGCATCGCGAACAGCGCCTGCTGGACGACCTGTCGCGCA
TCCGCCTGTATCTCCACGGAGATCGGCCTACCGCGTCGGCGCTGTACGCAGTCCTCACACAACAGGTCGA
GTCGATCGGCATGCGGATGCCGCGCCTGCTCGACTGTCAGCTGCAGCCGCAACCGGCCATGCGGTTCGAG
GCGGCCGGTTTCGGGCCGGATACTCGGCTGTGGCCGGTTGACCGCGACGCGCGTGACGCTGAACTCGATC
GCGAGCAGACCATGCTTGAGTATTTCGCGTTCCCGGAAAAATTCCACTTCGTTGACCTCTGCGGATTCAA
CACGGCGGGCGTGCCGCCCGGCGAGACTCGCATCGAATTCGAGATCGTGCTTAACGGCCGCATTGCCGGG
GACGTGACGTTCGGCGCGAACAACATCCGTTTGTTCTGCACGCCGGTGATCAACCTGTTCGAGCTGGACG
CACAGGCGATTCGACCCAACGCGCATGATCGGGACTATCCGGTACGTCCGCCCGCGTCAGCCGGCGATCA
TATCGAGCCATATGACGCACAGTCGGTCGTGGCAGCCGATCCCCGCAACGCGATGTACCACGAATACCAG
TCTTTCAAGGAATTCCGGCACCGTGGCGGGATGATGCGCTACGAGTCGCCCGAGCGCTATTACCACTCAT
CCATCCGCCATGGTGTCACGGGGCAGCGTGAGATGTGGGTGACGTTAGGTGGCCATCTATGGGATGAACC
TGGTAGCGTGCCAGACGGGCACGTGACGGTCCGCGTGCTGGCAAATAATGGCCGCCTGCCGCGCATGGCG
CTAAGCGAATCGATGATTACCGAGCCTGTATCGGCGTTCTCCGGCGTCGAGCGGGTGCGCAATCTCACGG
CTCCCACGATGCCGCTGTATCCACCGCGCGGCGGCGAATACGACTGGAAGGTAGTCTCACACTTCAATGC
GGCTGGTTCGACGGAACTGAACATGATGGATGCGAGCGTCTTGCGTGGTGCGCTGTCGTTGTACGACTGG
TCGCCGCAGGACGACAACATGCGGCGCATCGAGGCGATCCACTATGTTTGGCTGGACGAAGACACTGAAA
TCATCGGTACGCGAGTCGACAGGATCGTGAACGTGAACGTCGGCATCGAGCCATCGGGTTTTGCCGGTCC
CGGCGATGTCGCACTCTTCGGCGACGTGCTGAGCCGCTTCGTTGGCCGCTATGCCTGCTTCCATTACGCG
GTGCGGCTCGTTTTATATCAGGGTGTAGGCGGGGCGGTTCGGCGTTATCCGCCCGTACTCAAGACGGGAG
ACTGGTTGTGA