SecReT6
Protein ID: 238024046
SecReT6 ID340
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g06020
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]729672..730208 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5AMJ2
KEGG IDbgl:bglu_2g06020
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.10E-39, Aligned region: 23..172
Protein Sequence: 178 a.a.     [Download]
>gi|238024046|ref|YP_002908278.1| unnamed protein product [Burkholderia glumae BGR1]
MTRQTHRTLRGIRLTGGLAAATALLVGCGMWQSIKETTVDATRAVFVEKVKQMNLVIESHAALNPNEQGR
SLPVVLRVYQLKDTKTFENAAYGQLLDDDRALLKADLTGSMEAILGPGATVTLSAPMADDVQAVGVVGFF
RDQGGASWQLVIPKSQWKKTDPVKLIVTGNQIELGTEH
 
Nucleotide Sequence: 537 bp     [Download]
>gi|339717964|ref|NC_012721.2|:729672-730208 Burkholderia glumae BGR1 chromosome 2, complete sequence
GTGACACGGCAAACGCATCGGACGCTGCGCGGAATCCGGCTGACAGGTGGACTGGCGGCGGCCACTGCAC
TGCTTGTCGGCTGCGGCATGTGGCAGTCGATCAAGGAAACGACCGTCGACGCCACGCGCGCGGTATTCGT
CGAGAAGGTGAAACAGATGAACCTTGTGATCGAAAGCCACGCTGCGCTGAACCCGAACGAGCAGGGCCGG
TCACTGCCGGTCGTACTACGCGTCTATCAATTGAAGGATACGAAGACCTTTGAAAATGCGGCTTATGGTC
AGCTACTTGACGATGATCGCGCGTTGCTAAAGGCCGACCTCACCGGCAGCATGGAGGCCATACTCGGCCC
CGGCGCAACGGTAACGCTGTCGGCGCCAATGGCGGACGATGTGCAGGCTGTGGGCGTCGTGGGTTTTTTT
CGCGATCAGGGCGGCGCCTCGTGGCAACTGGTAATTCCGAAGTCGCAGTGGAAGAAGACGGATCCCGTGA
AGCTCATCGTAACGGGCAACCAGATTGAACTGGGCACGGAACATTGA