SecReT6
Protein ID: 238024156
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07340
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]878998..880143 [-]
Producttype VI secretion system protein EvpK
NoteTssA
UniProt IDC5AMV2
KEGG IDbgl:bglu_2g07340
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-17, Aligned region: 71..129
Protein Sequence: 381 a.a.     [Download]
>gi|238024156|ref|YP_002908388.1| unnamed protein product [Burkholderia glumae BGR1]
MNPSLLADARQHFEQTLRISFDALLAPVEMYPPCGRPARECRSYSQINQERRHDDPSLPLGAWQRDLKRT
DWLKVSHLVADMLLHDSKDMQLLAWLYEAQIKQYGFAGIAPTLVLLREMVSRYWNEIHPFGSEGDFEHRA
NLIRSISDKHLAALRLTPLLRLEGGKTYCWADWERAHRHERMRAGGHAELPAEGATLEELQGALNATASA
DFLTLRARLCDALQAIAEMSAALDPRFGNEAPSMGKTIELLETIRSLVDGELHTRGVRTEPEAPLQADAT
ADDAAPAATEPHDTPGAAAAAPGGGPIASRADAYARLEEIAEYLMRQEPHSPVPYLVRRATLWGRMNTAE
LYQELFLRLGGQLNIFEMVGIENPGSPERQA
 
Nucleotide Sequence: 1146 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c880143-878998 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAATCCATCGCTTCTTGCCGACGCCCGGCAGCATTTCGAACAGACCCTGCGGATTTCCTTCGACGCGC
TGCTCGCGCCGGTCGAGATGTACCCGCCGTGCGGACGGCCGGCGCGCGAGTGCCGCAGCTACAGCCAGAT
CAACCAGGAGCGGCGCCATGACGACCCGAGCCTGCCGCTCGGGGCCTGGCAGCGCGACCTGAAGCGCACC
GACTGGCTCAAGGTCAGCCATCTGGTCGCGGACATGCTGCTCCACGACAGCAAGGACATGCAGCTGCTGG
CCTGGCTCTACGAGGCGCAGATCAAGCAATACGGCTTCGCCGGCATCGCGCCGACGCTGGTGCTGCTGCG
CGAGATGGTCTCGCGCTACTGGAACGAGATCCACCCGTTCGGGAGCGAGGGCGATTTCGAGCATCGCGCC
AACCTGATCCGCTCGATCTCCGACAAGCATCTCGCGGCGCTGCGGCTCACGCCGCTGCTGCGCCTGGAGG
GCGGCAAGACCTATTGCTGGGCCGACTGGGAGCGCGCGCATCGCCATGAGCGCATGCGCGCCGGCGGCCA
TGCCGAGCTGCCCGCCGAGGGCGCCACGCTGGAGGAGCTGCAGGGGGCGCTGAACGCCACCGCGAGCGCC
GATTTCCTGACGCTGCGCGCGCGGCTCTGCGACGCGCTGCAGGCGATCGCCGAGATGAGCGCGGCGCTCG
ATCCGCGCTTCGGCAACGAGGCGCCGAGCATGGGCAAGACCATCGAGCTGCTGGAGACGATCCGCTCGCT
GGTCGACGGCGAACTGCACACGCGCGGCGTGCGCACCGAGCCTGAAGCGCCGCTGCAGGCCGATGCCACG
GCCGATGACGCCGCGCCCGCTGCAACCGAGCCGCACGACACGCCGGGCGCGGCCGCCGCCGCGCCTGGGG
GCGGCCCGATCGCGAGCCGCGCCGACGCCTACGCGCGCCTCGAGGAAATCGCCGAGTACCTGATGCGCCA
GGAGCCGCACAGCCCGGTGCCGTACCTGGTGCGGCGCGCCACGCTGTGGGGCCGCATGAACACGGCCGAG
CTGTATCAGGAGCTGTTCCTGAGGCTCGGCGGGCAGCTGAACATCTTCGAGATGGTGGGGATCGAGAATC
CCGGCAGCCCCGAACGGCAGGCATAA