SecReT6
Protein ID: 238024158
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07360
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]884185..884964 [-]
Producttype IV / VI secretion system protein DotU
NoteTssL
UniProt IDC5AMV4
KEGG IDbgl:bglu_2g07360
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-24, Aligned region: 61..246
Protein Sequence: 259 a.a.     [Download]
>gi|238024158|ref|YP_002908390.1| unnamed protein product [Burkholderia glumae BGR1]
MRDAPHWPQPHPGTPDLVARFADFYQELAAIKAAQTGGWLAVYLAGDGAPQPVTGSEFAKRVSARLLALL
QRQERRHADEADTAAGRAERQARYLMAALADEVLIFELDWPGRDAWLPVLLEQAMFGSSNAGSRFFSMAE
QLIQDTARTALQAELASVFLLAMELGFKGRYRARQAQPQLERIRGQLYQVVFAASGKLDDEQPAFAEAYA
YPLTGRRDERLAPLSPWRNLGLYGLIGYLVLSVIAWFVLMHPFEHYLNG
 
Nucleotide Sequence: 780 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c884964-884185 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCGTGACGCCCCGCACTGGCCGCAGCCGCATCCGGGCACGCCCGATCTGGTGGCGCGCTTCGCCGACT
TCTACCAGGAGCTGGCCGCCATCAAGGCCGCCCAGACGGGCGGCTGGCTGGCCGTCTATCTGGCCGGCGA
CGGCGCGCCCCAGCCCGTCACCGGCAGCGAGTTCGCCAAGCGCGTGAGCGCGCGGCTGCTCGCCCTGCTG
CAACGCCAGGAGCGCCGCCACGCCGACGAGGCCGACACCGCGGCCGGGCGCGCGGAGCGGCAGGCGCGCT
ACCTGATGGCGGCGCTCGCCGACGAGGTGCTGATCTTCGAGCTCGACTGGCCCGGGCGCGACGCCTGGCT
GCCGGTGCTGCTGGAGCAGGCGATGTTCGGATCGAGCAACGCGGGCTCGCGGTTCTTCTCGATGGCCGAG
CAGCTGATCCAGGACACCGCGCGCACCGCGCTGCAAGCCGAGCTCGCCTCGGTGTTCCTGCTCGCGATGG
AGCTGGGCTTCAAGGGCCGCTACCGCGCGCGCCAGGCGCAGCCGCAGCTGGAACGGATCCGCGGCCAGCT
CTACCAGGTCGTGTTCGCCGCCAGCGGCAAGCTCGACGACGAGCAGCCGGCATTCGCCGAGGCCTACGCG
TATCCGCTCACGGGCCGCCGCGACGAGCGCCTCGCGCCGCTGTCGCCGTGGCGCAATCTCGGGCTCTACG
GGTTGATCGGCTACCTCGTGCTGTCGGTGATCGCGTGGTTCGTGCTGATGCACCCGTTCGAACATTATCT
GAATGGCTAG