SecReT6
Protein ID: 238024159
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07370
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]884957..886405 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC5AMV5
KEGG IDbgl:bglu_2g07370
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-34, Aligned region: 23..332
Protein Sequence: 482 a.a.     [Download]
>gi|238024159|ref|YP_002908391.1| unnamed protein product [Burkholderia glumae BGR1]
MTPNAPLPDAVQWSEGMMLSPQHLQQNDRYWHAHLRHRLQAVAPHYWGVLTLRFEIVKEILSIGELECIL
PDGLLVAFPGGLPRNPPGNVEIDVGAACRSGEAPVKVWCVVNPRGSHAAVQDSQERRYNSVLDEPSVDEN
TGDGALSLPRLQVRFQLHLGTISPAPQSAVPLLEFVRGDNQQLQVTAYHAPMLRIEAADCLGQTSLWRQL
HAFHDRLWDKLSQLAEPGRSGDTEDTAGNERRQHLAAARQIGACLPPLSTLLHGRTHPEALYQALARIVG
AVSGIGPNPLPLLMKPYQHDDCQPQFQQAMAFVANRLDTVDTRYETLAFLRTDQHDASLPEACFERRLPA
GMGDDLIVELEPREAQTPSQLQAWLDEAMIADAALMPLLRRARVAGATARPLQPHEIEREKLRPQACLFW
VRNQPLALDDQGAQTAFGDSAMLQIVGRKNDGLPAAIVLYRRKQKNGASAGAAPAPSGDQHA
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c886405-884957 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGACGCCCAACGCCCCCCTCCCCGACGCAGTGCAATGGTCGGAAGGCATGATGCTCTCGCCCCAGCATC
TGCAACAGAACGACCGCTACTGGCACGCGCATCTGCGCCATCGCCTGCAGGCCGTGGCGCCGCACTACTG
GGGCGTGCTGACGCTGCGCTTCGAGATCGTCAAGGAGATCCTCAGCATCGGCGAGCTCGAATGCATCCTG
CCCGACGGGCTGCTGGTCGCGTTCCCCGGCGGCCTGCCGCGCAATCCGCCCGGCAACGTCGAGATCGACG
TCGGCGCGGCCTGCCGCAGCGGCGAGGCGCCGGTCAAGGTGTGGTGCGTGGTCAACCCGCGCGGCTCGCA
TGCCGCCGTGCAGGACAGCCAGGAGCGCCGCTACAACTCGGTGCTCGACGAGCCCAGCGTGGACGAGAAC
ACCGGCGACGGCGCGCTGTCGCTGCCGCGCCTGCAGGTGCGCTTCCAGCTCCACCTCGGCACGATCTCGC
CGGCGCCGCAGAGCGCCGTGCCGCTGCTCGAGTTCGTGCGCGGCGACAACCAGCAGCTGCAGGTCACCGC
CTACCACGCGCCGATGCTGCGCATCGAGGCGGCCGACTGCCTCGGCCAGACGAGCCTCTGGCGCCAGCTG
CACGCGTTCCACGACCGCCTGTGGGACAAGCTCTCGCAGCTCGCCGAGCCGGGCAGGTCCGGCGACACCG
AGGACACCGCCGGCAACGAGCGCCGCCAGCATCTGGCCGCCGCGCGCCAGATCGGCGCGTGCCTGCCGCC
GCTCTCCACGCTGCTGCACGGGCGCACCCATCCCGAGGCGCTCTACCAGGCGCTCGCGCGGATCGTCGGC
GCGGTGTCGGGCATCGGCCCCAACCCGCTGCCGCTGCTGATGAAGCCGTATCAGCACGACGACTGCCAGC
CGCAGTTCCAGCAGGCCATGGCGTTCGTCGCCAACCGGCTGGACACGGTCGATACGCGCTACGAGACGCT
CGCGTTCCTGCGCACCGACCAGCACGACGCCAGCCTGCCCGAGGCCTGCTTCGAGCGCCGCCTGCCGGCC
GGCATGGGCGACGACCTGATCGTCGAGCTCGAGCCGCGCGAGGCGCAGACGCCCTCGCAACTGCAGGCGT
GGCTCGACGAGGCGATGATCGCCGACGCCGCGCTGATGCCGCTGCTGCGCCGCGCGCGGGTGGCCGGCGC
GACGGCGCGGCCGTTGCAGCCGCACGAGATCGAGCGCGAGAAGCTGCGCCCGCAGGCCTGCCTGTTCTGG
GTGAGGAACCAGCCGCTCGCGCTCGACGACCAGGGCGCGCAGACCGCGTTCGGCGACAGCGCGATGCTGC
AGATCGTCGGCCGCAAGAACGACGGCCTGCCGGCCGCGATCGTGCTGTATCGCCGCAAGCAGAAGAACGG
CGCGAGCGCCGGCGCCGCGCCGGCGCCGTCCGGGGACCAGCATGCGTGA