SecReT6
Protein ID: 238024166
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07440
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]894260..895084 [-]
Productquinoprotein dehydrogenase
NoteTssG
UniProt IDC5AMW2
KEGG IDbgl:bglu_2g07440
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-48, Aligned region: 1..249
Protein Sequence: 274 a.a.     [Download]
>gi|238024166|ref|YP_002908398.1| unnamed protein product [Burkholderia glumae BGR1]
MPEPFTEWARELAALRATAMADFFDIFNQRANVLRYELKQRLTPGLDDTPPERTEAAGCLAALVGLGSPQ
LSSRVPLPQRAWLGIAGLLANRRRQGATLVEVLRVALGARVELTENVGAWHDLDERDRCALGRRNHRLGQ
TSVVGRRVWDQQARVRLEIGVLDYAALCRLLPPAPNPAPAAVPGLAAPAAPGYAMLSGLVKLLVDRLADV
EIVLQVDDASIPDAGTPLPQPARGTDGSSMRLGQSAWLAGAPAHRHATRPVRFLITTRDSGSLA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c895084-894260 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCCCGAGCCGTTCACCGAGTGGGCGCGCGAACTCGCGGCGCTGCGCGCGACCGCGATGGCCGACTTCT
TCGACATCTTCAACCAGCGCGCCAACGTGCTGCGCTACGAGCTGAAGCAGCGCCTCACGCCGGGCCTCGA
CGACACGCCGCCGGAGCGCACCGAGGCGGCCGGCTGCCTGGCGGCGCTGGTCGGCCTGGGCAGCCCGCAG
CTGAGCAGCCGGGTGCCGCTGCCGCAGCGCGCCTGGCTCGGCATCGCGGGCCTGCTGGCGAACCGGCGCC
GGCAGGGCGCGACGCTGGTGGAGGTGCTGCGCGTGGCGCTCGGCGCGCGCGTCGAGCTGACCGAGAACGT
CGGCGCGTGGCACGACCTCGACGAGCGCGACCGCTGCGCGCTCGGCCGCCGCAATCACCGGCTCGGCCAG
ACCAGCGTGGTGGGGCGCCGCGTGTGGGACCAGCAGGCGCGCGTGCGCCTCGAGATCGGCGTGCTCGACT
ACGCGGCGCTGTGCCGCCTGCTGCCGCCCGCGCCGAACCCGGCGCCGGCCGCCGTGCCCGGCCTGGCCGC
GCCGGCCGCGCCCGGTTACGCGATGCTCAGCGGCCTCGTGAAGCTGCTGGTCGATCGCCTCGCCGACGTC
GAGATCGTGCTGCAGGTGGACGACGCGAGCATCCCCGACGCCGGCACGCCGCTGCCCCAGCCCGCGCGCG
GCACCGACGGCAGCTCGATGCGGCTCGGCCAGAGCGCCTGGCTCGCCGGCGCGCCCGCGCATCGCCACGC
CACGCGGCCGGTGCGCTTTCTCATCACCACCCGCGATTCCGGGAGCCTCGCATGA