SecReT6
Protein ID: 238024167
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07450
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]895419..897269 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDC5AMW3
KEGG IDbgl:bglu_2g07450
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-141, Aligned region: 9..614
Protein Sequence: 616 a.a.     [Download]
>gi|238024167|ref|YP_002908399.1| unnamed protein product [Burkholderia glumae BGR1]
MQAATVTLSDCFREELASLRTESVQFSEKHRELARTLGLNAREASDPQVELLLQSFAFLAARLRHQVELD
KARLPNTLLSFLYPHLEAPIPSMLIARIDVKPDGTDYAKEQLLQRGRTVNALTANQLGQNVECRFQTCYD
TPLLPLRIDAVVLESASEYAFAGAGSSSRSVLRVRLSAAGVGTLQSKGRGPRRLRFYIDDAQPDAVALYE
MIALHLESIHVLPAAPLTPGAQPLRQLPAEALRWLGMEPDEAVLSANPHTHPGYRLLQEYFAFPEKFGFF
EIGRLDELDFSGVSEYFDLLLMLDMPFDPKHHFSAHSLVLNCVPLVNLFTQRIEPIALDHSEYEYRVTGD
FTNHRYCEIHSIRELESISSEGKPRPIAPYFAMDNFASLEGQDYFYLCRRLPATAANVAGSEMFVSFLDQ
QFNLGQLTDEVVGGTALCTNRRLPERLMSGSALHLEGGGPVNRIVAMTKPTQHHTPPQIGSRPWSLVSQL
ALNHLSLDGGALALAALKDILRLHVGPHRESGWKQIDAITELRSRSIMRHVGRDGWRGFVRGSELTVVME
PIDIGAGSVVRFCSVLREFLRGYASVNHLVEVALETRNLKGSPKQWQASAGTAIAL
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c897269-895419 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCAAGCCGCCACCGTCACGCTCAGCGACTGCTTCCGCGAGGAACTCGCCTCGCTGCGCACCGAGTCGG
TCCAGTTCAGCGAGAAGCATCGCGAGCTGGCCCGCACGCTCGGCCTCAACGCGCGCGAGGCGAGCGACCC
GCAGGTCGAGCTGCTGCTGCAGTCGTTCGCCTTTCTCGCGGCACGCCTGCGGCACCAGGTGGAACTGGAC
AAGGCGCGCCTGCCCAATACCCTGCTGTCGTTCCTCTATCCGCACCTGGAGGCGCCGATCCCGTCGATGC
TGATCGCGCGCATCGACGTGAAGCCCGACGGCACCGACTATGCCAAGGAACAACTGCTGCAGCGCGGCCG
CACCGTGAATGCGCTGACCGCCAACCAGCTCGGCCAGAACGTCGAGTGCCGGTTCCAGACCTGCTACGAC
ACCCCGCTGCTGCCGCTGCGCATCGACGCCGTGGTGCTCGAATCGGCGAGCGAATACGCGTTCGCGGGCG
CCGGCTCGTCGTCGCGCTCGGTGCTGCGGGTCCGTCTCTCGGCGGCCGGCGTCGGCACCCTGCAGTCGAA
GGGGCGCGGGCCGCGCCGGCTGCGCTTCTACATCGACGACGCGCAGCCCGACGCGGTGGCGCTCTACGAG
ATGATCGCGCTGCACCTGGAGAGCATCCACGTGCTGCCGGCCGCGCCGCTCACGCCCGGCGCGCAGCCCC
TGCGGCAGCTGCCGGCCGAGGCGCTGCGCTGGCTCGGCATGGAACCCGACGAGGCGGTGCTCAGCGCCAA
CCCGCACACGCACCCCGGCTATCGCCTGCTGCAGGAGTATTTCGCGTTTCCGGAGAAGTTCGGCTTCTTC
GAGATCGGCCGGCTCGACGAGCTCGACTTCAGCGGCGTGAGCGAGTATTTCGACCTGCTGCTGATGCTCG
ACATGCCGTTCGACCCCAAGCATCATTTCTCGGCCCACTCGCTGGTGCTGAACTGCGTGCCGCTCGTCAA
CCTCTTCACGCAGCGCATCGAGCCGATCGCGCTCGATCACAGCGAGTACGAATACCGCGTGACGGGCGAC
TTCACGAATCACCGCTACTGCGAGATCCATTCGATCCGCGAGCTCGAATCGATCTCGAGCGAGGGCAAGC
CGCGTCCGATCGCGCCTTACTTCGCGATGGACAACTTCGCCAGCCTGGAAGGCCAGGACTATTTCTATCT
GTGCCGGCGCCTGCCGGCCACCGCCGCCAACGTCGCGGGCAGCGAGATGTTCGTCTCGTTCCTCGACCAG
CAGTTCAACCTCGGCCAGCTCACCGACGAGGTGGTGGGCGGCACCGCGCTCTGCACCAACCGGCGGCTGC
CGGAGCGCCTGATGTCGGGCAGCGCGCTGCACCTGGAAGGCGGCGGCCCGGTGAACCGGATCGTCGCGAT
GACCAAGCCGACCCAGCACCACACGCCGCCGCAGATCGGCAGCCGCCCGTGGTCGCTGGTCTCGCAGCTC
GCGCTCAACCACCTCTCGCTCGACGGCGGCGCGCTCGCGCTCGCCGCGCTGAAGGACATCCTGCGGCTGC
ACGTCGGCCCGCATCGCGAGAGCGGCTGGAAGCAGATCGACGCGATCACCGAGCTGCGCAGCCGCAGCAT
CATGCGCCACGTCGGGCGCGACGGCTGGCGCGGCTTCGTGCGCGGCTCGGAGCTGACGGTGGTGATGGAG
CCGATCGACATCGGCGCGGGCAGCGTGGTGCGGTTCTGCTCGGTGCTGCGCGAATTCCTGCGCGGCTACG
CGAGCGTCAATCATCTGGTCGAAGTCGCGCTCGAAACGCGTAACCTGAAGGGGAGCCCCAAGCAATGGCA
AGCATCGGCCGGCACCGCTATCGCACTGTAA