SecReT6
Protein ID: 238024168
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07460
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]897277..897654 [-]
Producthypothetical protein
NoteTssE
UniProt IDC5AMW4
KEGG IDbgl:bglu_2g07460
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-11, Aligned region: 21..110
Protein Sequence: 125 a.a.     [Download]
>gi|238024168|ref|YP_002908400.1| unnamed protein product [Burkholderia glumae BGR1]
MQFLFERLAEPPSFDGTQTFDLRAAVAAQIQRLVSARITRSGGERDLLDFGLPSVVEFELNSKPQLELYA
QRLARLIARYEPRLKSAKVRIEAHDEALCPYRIAIYGTLDPSNGVDVFHFELPSH
 
Nucleotide Sequence: 378 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c897654-897277 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCAGTTCCTGTTTGAGCGCCTGGCGGAACCTCCCTCGTTCGACGGCACGCAGACGTTCGATCTGCGCG
CCGCCGTCGCCGCGCAGATCCAGCGGCTGGTCAGCGCGCGCATCACGCGCTCGGGCGGCGAACGCGATCT
GCTCGACTTCGGTTTGCCGAGCGTGGTGGAGTTCGAGCTGAACAGCAAGCCGCAGCTCGAGCTGTATGCG
CAGCGGCTCGCCCGCCTCATCGCCCGCTACGAACCGCGCCTGAAGTCCGCCAAGGTGCGCATCGAGGCGC
ACGACGAGGCGCTTTGCCCGTATCGCATCGCGATCTACGGCACGCTCGACCCCAGCAACGGCGTGGACGT
GTTCCACTTCGAGCTGCCTTCCCACTGA