SecReT6
Protein ID: 238024169
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07470
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]897718..898275 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDC5AMW5
KEGG IDbgl:bglu_2g07470
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-23, Aligned region: 36..153
Protein Sequence: 185 a.a.     [Download]
>gi|238024169|ref|YP_002908401.1| unnamed protein product [Burkholderia glumae BGR1]
MDLILFQPGDQSIMNSDGSEIDNSGWTADGPSGLCIEIVSLHQGMKQQVTTDVSNNARTSGRPIITEFTL
VKYVDQTSVKLYEYCLGAKLLGSGAGAPSTIYIARESGGKTMNIIKIQLKDALISEIQLQTHPNDMPTEQ
FKLNFTEVIWTYTQQLNNMTAKGVKTAGWSLAKNMPIGGSFSGLV
 
Nucleotide Sequence: 558 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c898275-897718 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGATCTGATTCTCTTCCAGCCGGGCGATCAAAGCATCATGAACAGCGACGGCAGCGAGATCGACAACT
CGGGCTGGACGGCCGACGGCCCGTCGGGCCTGTGCATCGAAATCGTGTCGCTGCACCAGGGCATGAAGCA
GCAGGTCACCACCGACGTCAGCAACAACGCGCGGACCTCGGGCCGGCCCATCATCACCGAGTTCACGCTG
GTCAAGTACGTGGACCAGACCTCGGTGAAGCTCTACGAGTACTGCCTCGGCGCCAAGCTGCTGGGCAGCG
GCGCGGGCGCGCCGAGCACCATCTACATCGCCCGCGAGTCGGGCGGCAAGACGATGAACATCATCAAGAT
CCAGCTGAAGGACGCCCTGATCAGCGAGATCCAGCTGCAGACGCACCCGAACGACATGCCCACCGAGCAG
TTCAAGCTCAACTTCACCGAAGTCATCTGGACCTACACGCAGCAGCTCAACAACATGACTGCCAAGGGGG
TCAAGACGGCCGGCTGGAGTCTCGCCAAGAACATGCCGATCGGCGGCAGCTTCTCGGGGCTCGTCTGA