SecReT6
Protein ID: 238024170
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07480
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]898308..900488 [-]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDC5AMW6
KEGG IDbgl:bglu_2g07480
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-169, Aligned region: 278..725
DUF770 [PF05591], Evalue: 6.40E-30, Aligned region: 11..157
Protein Sequence: 726 a.a.     [Download]
>gi|238024170|ref|YP_002908402.1| unnamed protein product [Burkholderia glumae BGR1]
MSESVQKKLLRIRPPRVRITYDVETGGAIEKTELPFIVGILADLKGEREDAEHYPSLKERSMIEIDRDNF
DDVMKKIQPRATFTQLKQDDAALKALLVQDGDNALIFPNMEAFEPLKVIKALPSLNDIYVNRGKIRDLQA
RAETSDPVSKVLDAMIQGAVLGQAAVAAQPAVPDQPEVPAVPAVPADGDKPAVEAVPGKPAVKGTPAVAA
KDAVPALQDSAVETALAALADLRKKDVAVPDDLNVTKFAEQFKLFYVASNDDVAKITEARKRGAIAVIDA
LIAEIDKQLSDAVSSIMHCDSFKTMEATWRGLNYLVMNTETSTTLKLRVFDAQKEELRSDMVKAVEFDQS
ALFKMIYEAEYGTYGGKPYSLLVGDYAIAKTPQDIEFVTKMAEVAAAAHAPFLAQASTDLFSLANFGELD
KPRDLKKIFEGEEYEAWREFRDLEDARYVTLALPRALLRLPYGMPTKRSTTPCDGINFDERIGASGKDDT
LYGKDASEPLSYAKPAPDHLLWGNPAYLLAQRITNAFAHYSWTAAIRGEEGGGLVENLPLYTYTSDNGST
ELLCPTEISITDRREKELNDLGFISLCHCKGTGKAAFFGGQTTNQPKKYFSDAANANARISALLPYMLAA
SRFAHYIKVIMRQKIGSFQTRGNVEDYLNSWISNYVLLDDNASQDAKAAYPLREAKVQVSEVPGEPGSYR
AVVFLKPHFQLEELTTSIRLVANLPK
 
Nucleotide Sequence: 2181 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c900488-898308 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGTGAAAGCGTGCAGAAGAAGCTCCTGCGTATTCGCCCTCCCCGGGTGAGGATCACGTACGACGTGG
AGACGGGTGGCGCCATCGAGAAGACGGAGCTGCCGTTCATCGTCGGCATCCTGGCCGACCTGAAGGGCGA
GCGCGAAGATGCGGAACACTATCCGTCGCTGAAGGAGCGGTCGATGATCGAGATCGATCGCGACAACTTC
GACGACGTGATGAAGAAGATCCAGCCGCGCGCCACCTTCACGCAGCTGAAGCAGGACGACGCGGCGCTGA
AGGCTCTGCTCGTGCAGGACGGCGACAACGCGCTGATCTTCCCGAACATGGAAGCGTTCGAACCGCTGAA
GGTGATCAAGGCGCTGCCGTCGCTGAACGACATCTACGTCAACCGCGGCAAGATCCGCGACCTGCAGGCG
CGCGCGGAAACGAGCGACCCCGTCAGCAAGGTGCTCGATGCGATGATCCAAGGCGCGGTGCTCGGCCAGG
CCGCCGTGGCGGCCCAGCCCGCGGTGCCCGATCAGCCCGAGGTGCCAGCCGTGCCGGCCGTGCCGGCCGA
CGGCGACAAGCCGGCCGTCGAGGCGGTGCCGGGCAAGCCCGCCGTCAAGGGCACGCCGGCGGTGGCGGCC
AAGGATGCCGTGCCGGCCCTGCAGGACTCGGCCGTCGAGACCGCGCTCGCGGCGCTCGCCGATCTGCGCA
AGAAGGACGTCGCGGTGCCCGACGATCTGAACGTCACGAAGTTCGCGGAGCAGTTCAAGCTCTTCTACGT
CGCCAGCAACGACGACGTGGCGAAGATCACCGAGGCGCGCAAGCGCGGCGCGATTGCCGTGATCGACGCG
CTGATCGCCGAGATCGACAAGCAGCTCAGCGACGCGGTGTCGAGCATCATGCACTGCGACAGCTTCAAGA
CGATGGAGGCGACCTGGCGCGGCCTCAACTACCTGGTGATGAACACCGAGACCAGCACGACGCTGAAGCT
GCGCGTGTTCGACGCCCAGAAGGAAGAGCTGCGCAGCGACATGGTGAAGGCGGTCGAGTTCGACCAGAGC
GCCCTCTTCAAGATGATCTACGAGGCCGAGTACGGCACCTACGGCGGCAAGCCGTACAGCCTGCTGGTGG
GCGACTACGCGATCGCCAAGACCCCGCAGGACATCGAGTTCGTCACCAAGATGGCCGAGGTGGCCGCCGC
CGCCCACGCGCCGTTCCTCGCGCAGGCATCGACCGATCTGTTCAGCCTCGCGAACTTCGGCGAGCTCGAC
AAGCCGCGCGATCTGAAGAAGATCTTCGAGGGCGAGGAGTACGAGGCATGGCGCGAATTCCGCGACCTCG
AGGACGCGCGCTACGTCACGCTCGCGCTGCCGCGCGCGCTGCTGCGCCTGCCCTACGGCATGCCCACCAA
GCGCAGCACCACGCCGTGCGACGGCATCAACTTCGACGAGCGCATCGGCGCCTCGGGCAAGGACGACACG
CTCTACGGCAAGGACGCCAGCGAGCCGCTCAGCTACGCGAAGCCGGCCCCGGACCATCTGCTGTGGGGCA
ACCCGGCCTACCTGCTCGCGCAGCGCATCACCAACGCGTTCGCGCACTACAGCTGGACGGCGGCGATCCG
CGGCGAGGAAGGCGGCGGCCTGGTGGAGAACCTGCCGCTCTATACCTACACCTCCGACAACGGCAGCACC
GAGCTGCTCTGCCCGACCGAGATCTCGATCACCGATCGCCGCGAGAAGGAGCTCAACGACCTCGGCTTCA
TCTCGCTCTGCCATTGCAAGGGCACCGGCAAGGCGGCGTTCTTCGGCGGCCAGACCACCAACCAGCCGAA
GAAGTACTTCTCGGACGCGGCCAACGCCAACGCCCGGATCTCCGCGCTGCTGCCGTACATGCTCGCCGCG
TCGCGCTTCGCGCATTACATCAAGGTCATCATGCGTCAGAAGATCGGCTCGTTCCAGACCCGCGGCAACG
TCGAGGACTACCTCAACTCGTGGATCTCGAACTACGTGCTGCTCGACGACAACGCCTCGCAGGACGCCAA
GGCCGCCTACCCGCTGCGTGAAGCGAAGGTGCAGGTGAGCGAGGTGCCGGGCGAGCCGGGCTCGTACCGC
GCCGTGGTGTTCCTCAAGCCGCACTTCCAGCTCGAGGAGCTGACGACTTCGATCCGGCTCGTGGCCAACC
TGCCGAAATAA