SecReT6
Protein ID: 238024484
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10830
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1382281..1385334 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC5AHV1
KEGG IDbgl:bglu_2g10830
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-67, Aligned region: 46..355
DUF2345 [PF10106], Evalue: 2.10E-56, Aligned region: 357..384
DUF2345 [PF10106], Evalue: 2.10E-56, Aligned region: 612..644
DUF2345 [PF10106], Evalue: 2.10E-56, Aligned region: 666..818
DUF2345 [PF10106], Evalue: 2.10E-56, Aligned region: 867..912
T6SS_Vgr [PF13296], Evalue: 2.30E-36, Aligned region: 523..629
T6SS_Vgr [PF13296], Evalue: 2.30E-36, Aligned region: 688..707
Phage_base_V [PF04717], Evalue: 3.10E-19, Aligned region: 423..513
Protein Sequence: 1017 a.a.     [Download]
>gi|238024484|ref|YP_002908716.1| unnamed protein product [Burkholderia glumae BGR1]
MGLQVDIQSIMSALRGGLLQQDRLLKLDTPLPADTLIVSRAVGHARLGRDVEWTLDVVSTVSNLELKALI
AQPVTLWIQQGDGGYRPVHGYVLVVRRLGSDGAMTLYQLRFTSALHFLRYRRDERYWQDQAADAIIADVL
NRHPQLQGRFRFDLSRKLPTRSYCRQHETDWNFVHRLMESEGLYCYWEYASDGSSQTMVIVDALYATPAP
FDVWFQRQGTHVEADALGHWASSRVLQSAHHTTRTFDYKNPSTPYNPKGTTLPTRADQGELPQQLEVYEY
TGAYAYAEHERGESLSQIQVEEWESRAKRFHGSGGVRAIDAGRRFVLHGHPEHDRDRAQQREFVAIDVQW
TIQNNVAIPDFRFPHSLAEAPEFARAASGGQAQTVMHADGSTGFYHVDIEAQRTTVPYRSPLEHEKPEMH
LETATVVGPSGEEVYTDELNRVKVRFHWDRQNDGDERASCWLRVAQSDSGSGYGGVHLPRVGEEVGVGYF
GGDCDRPIVLFRVFNGKTRPQWHSNGILSGFRTKEYAGSGFNELVMDDATGQNRAKLASSVGSTALHLGY
LIDQQGNLRGNYLGSGFDLRTDHYGAVRANRGLYVTTHAKGAASQPLDAGETQRQLESAGSLMDTLSQAG
VEHHAEGLDSGRAALKSLLDATRLDAAGAVLGGRTAGGGTGKANAFAEPVMMFGSPAGIGLSTQQAAQIH
ADQQINLVSGESLHLAAGKSLIASVAQKLSLFVQSAGMKLFAGKGKVEIQAHSDNVEVTAQQTVKVLSSG
AGVEVAAKDGILLTSGNAYIRIKDGNIEIHAPGKVDVKGAEHLFAGPQGTHYPLPPLPQGELIGKHSLRF
ATFGADQLADDIGWTNKPFQIVNTASEVLAAGQIAADGRLPRTLVDAAQTLVLKVGTGKWETHEVVAETP
GSEPADGPSADPAGIAAAPSAAGAVVPPPGMAAGSTLGGAGESLPGSSEHADDADDAVRINSDATLSPQD
DPYFLPAEEQEGQFIDTQHLAALLTQTVLEKVSEGEQ
 
Nucleotide Sequence: 3054 bp     [Download]
>gi|339717964|ref|NC_012721.2|:1382281-1385334 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGGATTGCAGGTGGATATTCAATCGATAATGTCCGCGCTACGCGGCGGTCTGCTTCAACAGGACCGGT
TGCTCAAACTCGATACGCCATTGCCGGCCGACACGTTGATCGTTTCGCGTGCCGTCGGCCATGCCCGGCT
CGGCCGCGACGTCGAGTGGACGCTCGACGTCGTCTCGACGGTCAGCAACCTCGAGCTGAAGGCGCTGATC
GCGCAGCCAGTCACGCTGTGGATCCAGCAGGGCGACGGCGGCTATCGGCCGGTGCACGGCTACGTGCTGG
TGGTGCGCCGGCTCGGCTCGGACGGCGCGATGACGCTCTACCAGTTGCGCTTTACCTCGGCCCTGCACTT
CCTGCGCTACCGGCGCGACGAGCGCTACTGGCAGGACCAGGCCGCCGACGCGATCATCGCCGACGTGCTG
AACCGGCATCCGCAGCTGCAGGGCCGCTTTCGCTTCGATCTGTCGCGCAAGCTGCCGACGCGCTCGTATT
GCCGCCAGCACGAGACCGACTGGAACTTCGTGCACCGGCTGATGGAGTCCGAAGGGCTCTATTGCTACTG
GGAATATGCGTCGGACGGCAGCTCGCAGACGATGGTGATCGTCGACGCGCTGTACGCGACGCCGGCGCCG
TTCGACGTCTGGTTCCAGCGCCAGGGCACCCATGTCGAGGCCGACGCGCTGGGCCACTGGGCCAGCTCGC
GCGTGCTGCAGAGCGCCCACCACACCACGCGCACGTTCGACTACAAGAATCCTTCCACGCCGTACAACCC
GAAGGGCACCACGCTGCCCACGCGCGCCGATCAGGGCGAGCTGCCGCAACAGCTCGAGGTGTACGAATAC
ACCGGCGCCTATGCCTACGCCGAGCACGAGCGCGGGGAATCGCTGTCGCAGATCCAGGTCGAGGAATGGG
AATCGCGCGCCAAGCGCTTCCACGGCAGCGGCGGCGTGCGCGCGATCGATGCGGGCCGCCGCTTCGTGCT
GCACGGCCACCCCGAGCACGATCGCGACCGCGCCCAGCAGCGCGAGTTCGTGGCGATCGACGTGCAGTGG
ACGATCCAGAACAACGTGGCGATCCCCGATTTCCGTTTTCCGCACAGTCTCGCCGAAGCGCCCGAGTTCG
CGCGCGCGGCAAGCGGCGGCCAGGCGCAGACGGTCATGCACGCCGACGGCTCGACCGGCTTCTATCACGT
GGACATCGAGGCGCAGCGCACGACCGTTCCGTATCGCAGCCCGCTCGAGCACGAGAAGCCCGAGATGCAT
CTGGAGACCGCCACCGTGGTCGGCCCGAGCGGCGAGGAGGTGTATACCGACGAGCTGAACCGGGTCAAGG
TGCGGTTCCACTGGGACCGCCAGAACGACGGCGACGAGCGCGCCTCGTGCTGGCTGCGCGTGGCGCAGTC
CGATTCCGGCAGCGGCTACGGCGGCGTGCACCTGCCGCGGGTGGGCGAGGAGGTGGGGGTCGGCTATTTC
GGCGGCGACTGCGACCGGCCGATCGTGCTGTTTCGCGTGTTCAACGGCAAGACCCGGCCGCAGTGGCACA
GCAACGGCATTCTGTCGGGCTTTCGCACCAAGGAATACGCGGGCAGCGGCTTCAACGAGCTGGTGATGGA
CGACGCCACCGGCCAGAACCGCGCCAAGCTCGCGAGCAGCGTCGGCAGCACGGCGCTGCACCTGGGCTAC
CTGATCGACCAGCAGGGCAACCTGCGCGGCAACTATCTCGGCAGCGGCTTCGACCTGCGCACCGATCATT
ACGGCGCGGTGCGCGCCAACCGCGGCCTGTACGTGACCACCCACGCGAAGGGCGCGGCGAGCCAGCCGCT
CGACGCGGGCGAGACGCAGCGGCAGCTCGAGAGCGCCGGCAGCCTGATGGATACGCTCTCGCAGGCCGGC
GTCGAGCATCACGCCGAGGGGCTCGACAGCGGGCGCGCGGCGCTGAAGTCGCTGCTCGACGCGACCCGGC
TCGATGCCGCGGGCGCTGTGCTGGGCGGGCGCACCGCCGGCGGCGGCACCGGCAAGGCGAATGCCTTCGC
CGAGCCGGTGATGATGTTCGGCAGTCCGGCCGGGATCGGCCTGTCCACGCAGCAGGCCGCGCAGATCCAT
GCGGACCAGCAGATCAACCTGGTCAGCGGCGAGAGCCTGCATCTCGCGGCCGGCAAGTCGCTGATCGCGA
GCGTCGCGCAGAAGCTGAGCCTGTTCGTGCAGAGCGCCGGGATGAAGCTGTTCGCCGGCAAGGGCAAGGT
CGAGATCCAGGCCCATTCCGACAACGTCGAGGTGACCGCGCAGCAGACCGTGAAGGTGCTGTCCTCCGGC
GCGGGCGTCGAGGTGGCCGCGAAGGACGGAATTCTGCTGACCTCGGGCAACGCCTACATTCGCATCAAGG
ACGGCAACATCGAGATCCATGCGCCGGGCAAGGTCGACGTGAAGGGCGCCGAGCACCTGTTCGCCGGTCC
GCAGGGAACCCACTACCCGCTGCCGCCGCTGCCGCAGGGCGAACTGATCGGCAAGCACAGCCTGCGCTTC
GCGACCTTCGGCGCCGACCAGCTTGCCGACGACATCGGCTGGACCAACAAGCCGTTCCAGATCGTCAACA
CCGCGAGCGAGGTGCTGGCGGCCGGGCAGATCGCGGCCGACGGCCGGCTGCCGCGCACGCTCGTCGACGC
CGCGCAGACGCTGGTGCTGAAGGTGGGCACCGGCAAATGGGAGACCCACGAAGTGGTGGCCGAGACGCCC
GGTTCGGAGCCGGCCGACGGCCCGAGCGCAGACCCCGCCGGTATCGCCGCGGCGCCGTCGGCAGCGGGGG
CCGTGGTTCCGCCGCCGGGCATGGCGGCCGGCAGCACGCTTGGCGGCGCGGGCGAGTCGCTGCCGGGCAG
CAGCGAGCACGCCGATGATGCCGACGACGCCGTGCGCATCAACAGCGACGCCACGCTGAGCCCGCAGGAC
GATCCGTATTTCCTTCCGGCAGAGGAGCAGGAAGGCCAGTTCATCGATACCCAGCATCTGGCGGCCCTGC
TGACGCAGACCGTGCTGGAGAAGGTTAGTGAAGGAGAGCAGTAA