SecReT6
Protein ID: 238024491
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10910
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1393584..1394141 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5AHV8
KEGG IDbgl:bglu_2g10910
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-37, Aligned region: 21..168
Protein Sequence: 185 a.a.     [Download]
>gi|238024491|ref|YP_002908723.1| unnamed protein product [Burkholderia glumae BGR1]
MPDRGVPMPIRVTLSILASTLLLSACGAWQAVSDASSSTYHAVFFKQTKVLNVDLSAREALNPDDAGRPT
SVAVRIYQLKDRKIFDQASYEDLLRNDRTVLSQDLLTSMASVINPGASASFTQRMQADTKYVAIVAFYRN
PGNGDGWKYVIEKKKLDADKPLKLELVDQLLIDARGTQSPASYIP
 
Nucleotide Sequence: 558 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1394141-1393584 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCCGGATCGAGGAGTTCCGATGCCTATTCGTGTCACTCTTTCAATTCTTGCGTCCACCTTGCTGCTGT
CGGCCTGCGGCGCATGGCAGGCTGTCTCGGACGCCTCGTCGAGCACGTATCACGCCGTGTTCTTCAAGCA
GACGAAGGTGCTCAACGTCGATCTTTCCGCCCGCGAAGCCTTGAATCCGGACGACGCCGGCCGCCCGACG
TCGGTTGCCGTGCGCATATACCAGCTCAAGGACCGGAAGATATTCGACCAGGCATCTTACGAGGACCTAC
TGAGGAACGACCGGACCGTGCTTTCTCAGGATCTGCTAACGAGCATGGCATCCGTGATCAACCCGGGCGC
GTCCGCAAGCTTTACACAGCGGATGCAGGCCGATACGAAGTACGTGGCCATCGTTGCGTTCTATCGAAAT
CCGGGCAACGGCGACGGCTGGAAATACGTGATCGAGAAAAAGAAGCTCGACGCTGACAAGCCGCTTAAAC
TGGAACTGGTTGACCAGTTGCTCATTGACGCTCGCGGAACCCAAAGCCCGGCGTCATACATCCCGTGA