SecReT6
Protein ID: 238024492
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10920
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1394290..1395411 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDC5AHV9
KEGG IDbgl:bglu_2g10920
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-86, Aligned region: 27..342
Protein Sequence: 373 a.a.     [Download]
>gi|238024492|ref|YP_002908724.1| unnamed protein product [Burkholderia glumae BGR1]
MSAREPKEVSLGDELPNLEPLVASLLARAPRMNFMQLCRLLEAQVPDAPGFGTRDSLEHERVRFRPRPRL
GFPAGEMASVELDDARPDAPPTIRTTFMGLYGVDAAVPAHMIDEIVRREEGHEAVEAFLDQFNHRYVTLL
YRAWKKYRYPESFRAGGADAHSRNLLCLAGFGWGDKPRRAGLPDSRMLALLGLLIQHTRTPEGLAGVIAL
AVPGVGVRVDEFFPALTRAGQPRPLTSTGEAAAAEDGARRGLGGSYVLGRRIAYRSRAVRVTLRPADARQ
AHDLLPGAWLHRELMAFVQLYVGVKADVHLRMEISSRLAPEPAIGPASTGPAPRLGWTTVLRAAEARLVN
IALGVYEAFPTPAPNPYLAARHG
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1395411-1394290 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAGCGCGCGCGAACCGAAGGAAGTCTCCTTGGGGGACGAACTGCCGAATCTCGAGCCACTCGTCGCGT
CGCTGCTCGCTCGCGCGCCCCGCATGAATTTCATGCAGCTGTGTCGGCTGCTCGAGGCGCAGGTGCCGGA
TGCCCCCGGTTTCGGCACGCGCGACTCGCTCGAGCATGAGCGGGTGCGTTTTCGGCCGCGGCCCCGCCTG
GGCTTTCCGGCCGGAGAAATGGCGTCGGTCGAGCTTGACGACGCACGGCCTGACGCGCCGCCCACCATAC
GGACGACGTTCATGGGTCTGTACGGCGTCGACGCGGCGGTGCCGGCGCACATGATCGACGAGATCGTGCG
GCGGGAGGAGGGGCATGAGGCGGTTGAAGCGTTTCTCGACCAGTTCAACCACCGGTACGTCACGCTGCTA
TACCGCGCTTGGAAGAAGTACCGCTATCCGGAAAGCTTCCGCGCAGGCGGCGCCGACGCGCATTCCCGCA
ATCTGCTGTGCCTGGCCGGGTTCGGCTGGGGCGACAAGCCGCGGCGCGCCGGTCTGCCGGATTCGCGGAT
GCTCGCGCTACTGGGGCTGCTGATCCAGCATACGCGCACGCCCGAGGGCCTCGCCGGCGTGATCGCGCTG
GCCGTGCCCGGCGTCGGCGTACGCGTCGACGAATTCTTTCCGGCGCTCACGCGTGCCGGACAGCCGCGGC
CGCTGACATCCACGGGCGAAGCCGCTGCGGCGGAAGACGGGGCGCGCCGGGGGCTGGGGGGCAGCTACGT
GCTCGGCCGGCGCATCGCCTACCGCAGCCGCGCGGTGCGAGTCACGCTGCGCCCGGCTGATGCCCGGCAG
GCCCACGACCTCCTGCCTGGCGCGTGGCTGCATCGCGAGCTGATGGCGTTCGTGCAACTGTACGTGGGGG
TGAAAGCCGACGTGCACCTGCGCATGGAGATTTCCTCCCGGCTTGCGCCCGAGCCTGCCATCGGCCCGGC
CTCAACCGGTCCGGCGCCGCGCCTTGGCTGGACGACCGTGCTGCGCGCCGCCGAGGCACGCCTCGTCAAC
ATCGCACTCGGCGTCTACGAGGCATTTCCCACGCCCGCGCCCAATCCATATTTGGCTGCACGACATGGCT
GA