SecReT6
Protein ID: 238024493
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10930
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1395408..1397222 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDC5AHW0
KEGG IDbgl:bglu_2g10930
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-181, Aligned region: 8..603
Protein Sequence: 604 a.a.     [Download]
>gi|238024493|ref|YP_002908725.1| unnamed protein product [Burkholderia glumae BGR1]
MENDDPILRYYEAEMRYLRESGREFAKAHPDRARLLNLDRVGDRDPYVERLFEGFAFLTGRLRQKLDDEL
PELTEGLVSLLWPHYLRMIPSLSVVQLIPLADKLQKTEIVPAGVPVRSAPIAIPPPAGADGSVPKTVQCL
YRTTQAVTLQPLSITHAGPSVRHDGRSVIRIGFALDGSARRNETDLTRLRVHLNADLPTAFAMHLALTRQ
VDAITWRIPEIRDGEAVPLSGVTIEPAGFSTEERLWPKAEAAFSGYQLLLEYFTFREKFLFVDLRGVDIT
KLPASATRFELEIVLKQAYPSDQRFSAENLRLFCSPVINLFELDAEPIVIDHHETEYRVVPAGHQGGHVE
TYSVDAIATFDHDTAERYEYVPFATFRHRGGMLRHEAPERYFHTRVRPGVSGLHETWVILGGHAWETMDT
LPEESLSLRVTGTNGLLPRKGLREASLDELAASPPNVAGVRNLVSPTLPLYPPTEDRFQWRVLSHLAPNF
LSMMNAEVLRGALALYDWTDDELNRRRLAGIRWVSQELIEEVTGGSVERGVLIEVTLDSHAFSGEGDVML
FGELLHRFFAQYAEINLFTKLSIVSLPSQTRTIWPRSKAQRAPL
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1397222-1395408 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGAAAACGACGACCCGATTCTGCGCTACTACGAGGCGGAAATGCGCTATTTGCGCGAGTCCGGCAGGG
AGTTCGCGAAAGCGCATCCCGATCGCGCGCGCCTGCTCAACCTCGATCGCGTGGGCGACCGCGATCCGTA
TGTCGAGCGGCTGTTCGAGGGCTTTGCATTCCTGACCGGCCGGCTTCGACAGAAACTCGACGATGAACTG
CCGGAGCTCACCGAGGGACTCGTGAGCCTCCTATGGCCGCACTATCTGCGGATGATCCCGTCGCTGTCGG
TGGTCCAGCTGATCCCGCTCGCGGACAAGCTGCAAAAAACCGAGATCGTGCCGGCAGGCGTGCCGGTTCG
CTCCGCGCCGATTGCGATACCGCCGCCGGCCGGCGCCGATGGCTCGGTGCCGAAGACGGTTCAGTGTCTA
TACCGAACCACGCAGGCCGTGACGCTGCAGCCGCTTTCGATCACGCATGCCGGCCCGAGTGTGCGCCATG
ACGGCCGTTCGGTGATCCGGATCGGGTTCGCGCTCGACGGGTCGGCGCGCCGCAACGAAACGGACCTGAC
GCGACTGCGCGTGCATCTGAATGCGGATCTGCCGACTGCGTTCGCAATGCATCTCGCGCTTACGCGCCAG
GTCGATGCAATCACCTGGCGCATTCCGGAAATCCGCGACGGCGAAGCGGTGCCGCTCTCCGGCGTCACGA
TCGAGCCGGCCGGTTTTTCGACCGAAGAACGGCTGTGGCCGAAGGCCGAGGCGGCTTTCTCGGGCTACCA
GCTGCTGCTCGAGTATTTTACGTTCCGCGAGAAATTCCTGTTCGTCGACCTACGCGGAGTCGACATCACG
AAGCTGCCCGCGAGCGCGACCCGCTTCGAGCTGGAAATCGTATTGAAGCAGGCCTATCCGTCGGACCAGC
GCTTCAGCGCCGAGAACCTGCGCCTCTTCTGCAGCCCGGTGATCAATCTGTTCGAACTGGATGCCGAACC
GATCGTGATCGATCATCACGAAACCGAATATCGCGTGGTGCCGGCAGGTCATCAGGGCGGGCATGTCGAA
ACCTACTCGGTCGACGCCATTGCGACATTCGACCATGACACGGCCGAGCGATACGAATACGTGCCGTTCG
CTACCTTCCGGCACCGCGGCGGCATGTTGCGGCACGAGGCGCCGGAGCGCTATTTCCATACGCGCGTGCG
ACCGGGTGTGTCCGGGCTGCACGAAACCTGGGTGATTCTCGGCGGTCATGCCTGGGAGACCATGGACACG
CTGCCCGAGGAAAGCCTGTCGCTGCGTGTGACGGGCACGAACGGACTGTTGCCGCGCAAGGGGCTGCGTG
AAGCCAGCCTCGACGAGCTGGCGGCCAGCCCCCCGAACGTCGCGGGCGTACGCAACCTCGTGTCGCCGAC
CTTGCCGCTGTATCCGCCGACCGAAGACCGTTTCCAGTGGCGCGTGTTATCGCATCTGGCGCCGAACTTC
CTGTCGATGATGAATGCGGAAGTGCTGCGCGGTGCACTCGCACTGTACGACTGGACCGACGACGAGCTGA
ATCGCCGCCGGCTGGCCGGCATCCGGTGGGTCTCGCAGGAGCTCATCGAGGAGGTGACGGGCGGCTCGGT
CGAGCGTGGCGTGCTGATCGAGGTGACGCTCGATTCGCATGCGTTTTCGGGCGAGGGCGACGTGATGCTG
TTCGGCGAGCTGCTGCACCGGTTCTTCGCGCAGTACGCGGAAATCAACCTGTTCACCAAGCTGTCGATCG
TGAGCCTGCCGTCGCAGACCCGCACGATCTGGCCGCGCAGCAAAGCGCAGCGGGCTCCGCTATGA