SecReT6
Protein ID: 238024494
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10940
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1397235..1398821 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDC5AHW1
KEGG IDbgl:bglu_2g10940
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 68..125
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 156..181
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 400..417
Protein Sequence: 528 a.a.     [Download]
>gi|238024494|ref|YP_002908726.1| unnamed protein product [Burkholderia glumae BGR1]
MMLGGLFKRLFPTRDDAEQLARTRLDAWHAWLLPLAGDTGVGRDPGYEDTFFALREETQKLSGIDDGLIV
SGCEQLLKETGKDLRLAGYYAFARLRQDGPSGFADGLELAAALVDRYGETVLPARAEAKRGALEMLATTR
MIEMLESRGAFAPADLERALAALDVLVACTQTWSDAARPNLQALISRFERNNEPALTAEQGAAVPSPLSA
ATAAFGTITSARDLLDQARTMAVWLRDQENGYLPSVRLVRSVRWDTLHEVPPADAASHTRLVAPRGELRQ
QMKRLVLQKQWHELLERVEGAFMEGVNHLWFDLQYFQHVALDHIGAPYSGWRAQLRADFALFLERLPGIE
RLAFADGTPFADDATLEWIARHAVVRDLEAGESVAPLPVSAESVGDAAGDWPEIEAQARELAGREGVEAA
FAWLEALPGMKTDRHRYLQRLVMARLADQASRPDTALALLAELDASSRTLPLTRWEPALVFEVKQQLVRA
LKAMSNRKDADKPALARRIGELQAELTVLDPARALTLS
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1398821-1397235 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGATGCTGGGCGGACTGTTCAAACGCCTTTTTCCGACCCGCGACGACGCCGAGCAGCTCGCGCGGACGC
GGCTCGACGCGTGGCATGCGTGGCTGCTGCCGCTCGCGGGTGACACGGGCGTGGGGCGCGACCCGGGCTA
CGAGGATACGTTCTTCGCGCTTCGGGAGGAGACGCAAAAGCTCTCCGGCATCGACGACGGCCTCATCGTG
AGTGGCTGTGAGCAGTTGCTCAAGGAGACCGGCAAGGATCTGCGTCTGGCCGGTTACTACGCGTTCGCGC
GGCTGCGGCAGGACGGACCTTCCGGCTTTGCCGACGGGCTCGAGCTGGCCGCGGCGCTCGTCGACCGCTA
CGGCGAGACCGTGTTGCCCGCACGCGCCGAGGCAAAAAGGGGCGCGCTCGAGATGCTGGCGACCACGCGC
ATGATCGAGATGCTGGAAAGCCGTGGCGCGTTCGCACCGGCTGACCTCGAGCGCGCACTGGCCGCGCTCG
ACGTGCTGGTGGCCTGCACGCAGACCTGGTCCGACGCCGCGCGCCCGAACCTGCAAGCGCTCATCTCTCG
CTTCGAGCGAAACAATGAGCCCGCTCTCACGGCCGAGCAGGGCGCCGCCGTGCCTTCACCGCTTTCCGCG
GCGACGGCTGCCTTCGGCACGATCACGTCGGCGCGGGACCTGCTCGATCAGGCGCGCACGATGGCGGTGT
GGCTGCGCGATCAGGAAAACGGCTATCTGCCGTCGGTGCGGCTCGTGCGCAGTGTGCGCTGGGATACGCT
GCACGAAGTGCCGCCGGCCGATGCCGCCTCGCATACGCGCCTCGTCGCGCCTCGCGGCGAACTTCGCCAG
CAGATGAAACGGCTCGTGCTGCAGAAGCAGTGGCACGAACTGCTCGAACGCGTCGAAGGCGCGTTCATGG
AGGGCGTCAACCATCTGTGGTTCGACCTGCAGTATTTCCAGCACGTCGCGCTCGACCATATCGGTGCGCC
GTATAGCGGATGGCGCGCACAGCTGCGCGCAGACTTTGCGCTCTTCCTCGAACGACTGCCCGGCATCGAA
CGGCTGGCGTTCGCCGACGGCACGCCGTTCGCCGACGATGCAACGCTCGAGTGGATCGCGCGGCACGCGG
TAGTGCGCGATCTGGAAGCGGGCGAGTCTGTCGCTCCGCTGCCGGTCTCGGCCGAGAGCGTCGGCGATGC
CGCCGGCGACTGGCCGGAAATCGAGGCGCAGGCGCGGGAACTGGCCGGGCGCGAGGGTGTGGAAGCCGCC
TTCGCTTGGCTTGAGGCACTGCCAGGCATGAAGACGGACCGCCATCGCTATCTGCAGCGGCTGGTGATGG
CGCGCCTGGCCGATCAGGCCAGCCGCCCGGATACGGCACTGGCGCTGCTGGCCGAGCTCGACGCCTCGTC
CCGGACACTGCCGCTCACGCGCTGGGAGCCGGCGCTGGTGTTCGAGGTCAAGCAGCAGCTGGTCCGCGCA
TTGAAGGCGATGAGCAACCGCAAGGATGCCGACAAGCCGGCGCTGGCCCGCCGCATCGGTGAACTGCAGG
CGGAACTGACCGTGCTCGATCCGGCGCGTGCCCTGACTCTCTCATAA