SecReT6
Protein ID: 238024500
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11030
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1409841..1412201 [-]
ProductHtype VI secretion system Vgr family protein
NoteTssI
UniProt IDC5AHW7
KEGG IDbgl:bglu_2g11030
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-55, Aligned region: 30..350
DUF2345 [PF10106], Evalue: 2.60E-48, Aligned region: 604..752
T6SS_Vgr [PF13296], Evalue: 1.10E-30, Aligned region: 335..351
T6SS_Vgr [PF13296], Evalue: 1.10E-30, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 1.50E-11, Aligned region: 109..146
Phage_base_V [PF04717], Evalue: 1.50E-11, Aligned region: 415..474
Phage_base_V [PF04717], Evalue: 1.50E-11, Aligned region: 568..588
Sarcoglycan_1 [PF04790], Evalue: 1.00E-05, Aligned region: 532..554
Sarcoglycan_1 [PF04790], Evalue: 1.00E-05, Aligned region: 674..726
Phasin_2 [PF09361], Evalue: 0.0065, Aligned region: 69..88
Phasin_2 [PF09361], Evalue: 0.0065, Aligned region: 562..613
Protein Sequence: 786 a.a.     [Download]
>gi|238024500|ref|YP_002908732.1| unnamed protein product [Burkholderia glumae BGR1]
MSSILPTQAYELKLAPHPAPFSVLEFSGRDAVSELYHYDIEFTSPAAGIPMEQVVGRPARFTIAPIDPNM
GYLRKMFGENAEQFSKMPPAHTIHGIITEFDEFATTADQTHYRVRLEPVLADLHRGVTSRLFQKQSIEEI
VTDTLRHYGYRVGVDFVFQLRHQYKRHEYVTQYHETTFAFIQRLCAQEGIWFRWEQKKDHAVIVFGDDLD
AYARKQRTVPYLRDAGLESSGADTIKTLEKRTRRVPEAVRLHDYNHREAGVSLLVEENAARADKSTNGVD
YRWGEHYETPEEGRQIARRRHEAYLANQITFKGTGNPFWLEAGEVMRVEPVQADAKHGIFITAVESSGGR
SQSYWVSFEGIPSDRAYRTPIASIKRPAIDGILPARITSPGNYKYAYLTEQGWYVIKLPFDLDEWSPGGT
SRPVRFAKPYSGDSYGHHFPLIDGAEVAIVFTDGNPDRPVIIGAMHDSLHPDLVNNLNHTRNIVRTAAQN
ELRMEDKENVEHIHLTTPFQTSELNLGHMVDGDRKERGQGAELRTDERVAVRGAKGVFISADAQYAARGK
QLDMEPAQGLLEQALQQMQSLAGAAKASQAIAADYEKQKALFDKTLNELRKAGILVSAPAGVGLVSGDHM
QFSADQNLIATAGGNADFGIIKRFTVAAGEAVSVFAQKLGLKFVAAKGKVEIHAQTDEIDMAAMKDITIS
SAEGRLVISAAKEVWIGAGGSYIKINANRIENGTPGDILEKCASWDKPGASSMRLPAPDLQSGDIKGCSW
RSAAAAADSAATVVLE
 
Nucleotide Sequence: 2361 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1412201-1409841 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGTCGTCGATCCTGCCTACCCAGGCCTACGAGTTGAAGCTCGCACCGCATCCGGCGCCGTTCTCGGTGC
TCGAGTTCAGCGGCCGGGACGCCGTGAGCGAGCTGTATCACTACGACATCGAGTTCACCAGCCCGGCAGC
GGGCATCCCGATGGAGCAGGTGGTCGGCCGGCCCGCGAGATTCACCATCGCTCCGATTGACCCGAACATG
GGCTACCTGCGCAAGATGTTCGGTGAGAACGCGGAGCAGTTCAGCAAGATGCCGCCCGCGCACACCATCC
ACGGCATCATCACGGAATTCGATGAATTCGCCACGACGGCCGACCAGACGCACTACCGGGTGCGGCTCGA
GCCGGTGCTCGCCGACCTGCACCGGGGCGTGACGAGCCGGCTGTTCCAGAAGCAGTCGATCGAGGAAATC
GTGACCGACACGCTGCGCCATTACGGCTACCGCGTCGGCGTCGACTTCGTGTTCCAACTGCGCCACCAGT
ACAAGCGGCACGAATACGTGACGCAGTACCACGAGACCACGTTTGCCTTCATCCAGCGCCTCTGTGCGCA
GGAGGGCATCTGGTTCCGCTGGGAGCAGAAGAAGGATCACGCGGTGATCGTGTTCGGCGACGATCTCGAT
GCCTATGCACGCAAACAGCGCACGGTGCCTTACCTGCGAGACGCCGGACTCGAGAGCTCAGGCGCGGACA
CGATCAAGACGCTAGAAAAGCGGACCCGGCGCGTACCCGAAGCCGTGCGGTTGCACGACTACAACCATCG
CGAGGCGGGCGTATCGCTGCTCGTCGAGGAAAACGCCGCGCGTGCCGACAAGTCGACGAACGGTGTCGAC
TACCGCTGGGGCGAGCATTACGAAACGCCGGAGGAGGGCAGGCAGATCGCCCGCCGGCGCCATGAGGCGT
ATCTGGCGAACCAGATCACCTTCAAGGGCACCGGCAATCCGTTCTGGCTGGAGGCGGGCGAAGTCATGCG
TGTCGAGCCGGTCCAGGCCGACGCGAAGCACGGGATCTTCATCACCGCGGTGGAATCGAGCGGCGGCCGT
AGCCAATCGTACTGGGTGAGCTTCGAGGGGATTCCGTCCGATCGCGCGTATCGAACGCCGATCGCCTCGA
TCAAGCGACCGGCCATTGACGGCATCCTGCCGGCCCGCATTACATCGCCGGGCAACTACAAATACGCGTA
CCTGACCGAGCAGGGCTGGTACGTGATCAAGCTGCCGTTCGACCTCGACGAGTGGAGTCCGGGCGGTACG
AGCCGGCCGGTGCGGTTTGCCAAGCCGTACAGCGGGGACAGCTACGGGCACCACTTCCCGCTGATCGACG
GTGCGGAAGTCGCCATCGTCTTTACCGATGGCAATCCGGACCGGCCCGTGATCATCGGGGCCATGCACGA
CAGCCTGCATCCGGATCTTGTCAATAACCTCAATCACACCCGCAACATCGTTCGCACCGCGGCGCAGAAC
GAGCTGCGGATGGAGGATAAGGAAAACGTCGAGCACATCCACCTGACGACGCCGTTCCAGACCAGTGAGC
TCAATCTCGGGCACATGGTCGATGGGGACCGCAAGGAACGCGGACAAGGCGCGGAATTGCGGACTGACGA
GCGTGTGGCGGTGCGTGGCGCGAAGGGTGTTTTTATTTCGGCGGATGCCCAGTACGCCGCGCGCGGCAAG
CAGCTCGACATGGAGCCGGCCCAAGGACTCCTCGAACAGGCGCTACAGCAGATGCAATCGCTGGCCGGCG
CGGCGAAAGCTTCTCAGGCGATCGCTGCCGATTACGAGAAGCAGAAGGCATTATTCGACAAGACCCTGAA
CGAACTCAGGAAGGCAGGCATCCTCGTCAGCGCACCGGCGGGTGTTGGTCTCGTATCGGGGGACCACATG
CAGTTCAGTGCCGACCAGAATCTCATTGCCACGGCGGGAGGCAACGCTGATTTTGGGATCATCAAGCGCT
TTACCGTCGCTGCCGGGGAAGCGGTTTCCGTGTTCGCCCAGAAGCTCGGCCTGAAATTCGTTGCGGCGAA
GGGGAAGGTCGAAATTCACGCCCAGACGGACGAAATCGACATGGCTGCCATGAAGGACATCACGATTTCG
AGCGCCGAGGGGCGGCTCGTAATTTCGGCAGCCAAGGAGGTCTGGATCGGGGCGGGTGGCTCGTACATCA
AGATCAACGCAAATCGCATCGAGAACGGTACGCCAGGCGATATTCTCGAAAAGTGCGCATCGTGGGACAA
GCCGGGCGCATCTTCAATGCGTTTGCCTGCACCGGACCTGCAGTCCGGAGATATCAAGGGGTGTTCATGG
CGATCGGCAGCCGCGGCGGCCGATAGTGCAGCAACCGTGGTGCTGGAGTAA