SecReT6
Protein ID: 238024502
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11050
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1413874..1414386 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC5AHW9
KEGG IDbgl:bglu_2g11050
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-54, Aligned region: 5..158
Protein Sequence: 170 a.a.     [Download]
>gi|238024502|ref|YP_002908734.1| unnamed protein product [Burkholderia glumae BGR1]
MDSFQREIPKSRVSITLDLHTGGARKKVELPLKLLVAGDFSAGREQAPLAERKKINIDKNNFDAVLADYA
PDLKISAENTLAGDGSALPVNLSFRSMKDFEPEQVARQIPELQAMLAMRNLLRDLKSNLLDNGTFRREFE
KILKDKHLSDKLRSELAQVATAATQPEGQA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1414386-1413874 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGACAGCTTCCAGCGAGAAATTCCGAAAAGCCGCGTCTCGATTACGTTGGATCTGCATACGGGCGGAG
CCCGGAAGAAGGTCGAGCTGCCGCTCAAGCTGCTCGTCGCCGGCGACTTCAGCGCGGGTCGGGAACAGGC
GCCGCTGGCCGAACGCAAGAAGATCAATATCGACAAGAATAATTTCGATGCCGTGCTTGCCGACTATGCC
CCCGACCTGAAGATCTCCGCCGAGAACACGCTCGCGGGCGATGGTTCGGCGTTGCCGGTGAACCTCTCGT
TCCGGTCGATGAAAGACTTCGAGCCGGAGCAGGTGGCCCGGCAGATTCCGGAACTGCAGGCGATGCTGGC
AATGCGCAATCTGCTGCGGGATCTGAAAAGCAACCTGCTCGACAACGGCACCTTCAGGCGCGAGTTCGAG
AAGATCCTGAAGGATAAGCATCTGTCTGACAAGCTGCGCAGCGAGCTCGCGCAGGTCGCCACCGCAGCCA
CCCAACCGGAAGGTCAGGCCTGA