SecReT6
Protein ID: 238024503
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11060
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1414882..1416234 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC5AHX0
KEGG IDbgl:bglu_2g11060
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.00E-125, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|238024503|ref|YP_002908735.1| unnamed protein product [Burkholderia glumae BGR1]
MRIDKPLWHEGLVLTQQHFQQQDRWAGFAMQQVAAAALAEPWGTLGVEVDEEALATGRLKLTRLKLRFPD
GTPVDTTMADEVPPARELTQGMPADCQSVVVLAALALPDANGNNCRFDETTLARPRRSYREFVKVTDLNG
TGESEIAAERHAVRLLFDFESHADDTVCAVARLTRSTSGLFQVDHRFVPPCLTLGSHRLHLERVNRLADI
LQAKSLALGARRSERIEQVAEYGVADVQLFWLLHCIHAAWPQLRLFATHPNRPPEHLYVTLAQLASALMT
FSTGAQLTDIPAYDHARADEVFAQLESMIRDLLDAIIPSRVVSIGLTRKSPTTWSGQFLDERIVGDAADW
YLSVNAPMPVFELVEQFPRLCKIGAPDDVERIINSALLGIPLKAVQRVPAAIPVRLDNQYFALDSTSAAH
AEMLAARACQIYLPASVPDASLELYAVLRS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|339717964|ref|NC_012721.2|:1414882-1416234 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCGGATCGACAAACCGCTCTGGCATGAGGGCTTGGTCCTCACGCAGCAGCACTTTCAGCAGCAGGACC
GATGGGCGGGATTCGCGATGCAGCAGGTCGCGGCCGCTGCGCTCGCCGAACCATGGGGCACCCTAGGCGT
CGAGGTCGACGAGGAGGCCCTGGCAACGGGGCGCCTCAAGCTCACGCGGCTCAAGCTGCGCTTCCCGGAC
GGGACGCCGGTCGACACGACGATGGCCGATGAGGTTCCGCCAGCACGCGAACTGACACAAGGCATGCCTG
CCGATTGTCAAAGCGTCGTGGTGCTCGCCGCGCTCGCGCTACCGGATGCGAACGGCAACAACTGCCGCTT
CGATGAAACCACGCTTGCGCGTCCGCGTCGCTCGTACCGCGAGTTCGTCAAGGTGACGGACCTGAACGGG
ACGGGTGAGTCGGAGATCGCCGCCGAGCGGCACGCCGTGCGGCTCCTGTTCGACTTCGAGTCCCATGCCG
ACGATACTGTCTGCGCGGTCGCACGGCTTACCCGCAGCACGAGCGGCCTGTTCCAGGTCGATCATCGGTT
CGTGCCGCCATGCCTGACGCTCGGCAGCCATCGGCTTCACCTGGAGCGCGTCAATCGCCTCGCCGACATC
CTGCAGGCGAAAAGTCTTGCGCTCGGCGCGCGCCGCAGCGAGCGCATCGAACAGGTGGCCGAATATGGCG
TGGCTGACGTCCAGCTCTTTTGGCTGCTGCATTGCATTCATGCAGCATGGCCGCAACTGAGGCTATTTGC
CACTCATCCGAACCGGCCGCCGGAGCATCTGTATGTCACGCTGGCACAGCTCGCCAGTGCGTTGATGACA
TTCTCGACGGGTGCCCAGCTGACCGACATTCCCGCGTACGACCACGCACGTGCCGACGAGGTGTTCGCAC
AGCTCGAATCGATGATTCGTGATCTGCTCGACGCGATCATCCCTTCACGAGTGGTGTCGATCGGCCTGAC
CCGCAAGAGCCCTACGACGTGGAGCGGCCAGTTCCTCGACGAACGCATCGTCGGCGATGCAGCCGACTGG
TATCTGTCCGTCAACGCACCGATGCCTGTGTTCGAGCTGGTCGAGCAGTTCCCGCGGCTGTGCAAGATCG
GCGCGCCAGACGACGTCGAGCGCATCATCAACTCGGCGCTGCTGGGAATTCCGCTGAAGGCGGTGCAGCG
CGTGCCGGCCGCGATTCCCGTGCGCCTTGACAACCAGTATTTCGCACTGGATTCGACCAGCGCTGCGCAC
GCGGAGATGCTCGCCGCGCGGGCCTGCCAGATCTATCTTCCCGCGTCCGTACCCGACGCCTCGCTTGAAC
TTTACGCGGTGCTGCGCTCATGA