SecReT6
Protein ID: 238024506
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11090
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1418865..1419350 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDC5AHX3
KEGG IDbgl:bglu_2g11090
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|238024506|ref|YP_002908738.1| unnamed protein product [Burkholderia glumae BGR1]
MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFNHGVHIPTDGNTGKLTGTRVHKPITLTKETDASTP
YLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVNPVMYDIKNPDYEKHNHLENVELRYE
TITWSYKDGNIIHKDTWNERS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|339717964|ref|NC_012721.2|:1418865-1419350 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGGCAATTCCGGCCTATATGTGGCTCAAGGACGATGGCGGTGCCGACATCAAGGGTTCGGTGACGGTTC
AGGGCCGAGAAGGCAGCGTCGAGCTCGTCGCGTTCAATCACGGCGTGCACATCCCGACCGACGGCAACAC
GGGCAAGCTCACCGGTACGCGTGTACACAAGCCGATTACGCTCACGAAGGAAACGGACGCGTCGACGCCA
TACCTGTACAAGGCCGTGACGAGCGGCCAGACGTTGAAGTCGGTCGAAATCAAGTGGTACAAGATCGACG
ACGCGGGCAAGGAGAAGGAGTACTTCAACACGAAGCTCGACAACGTCAAGATCGTGGCCGTCAACCCGGT
GATGTACGACATCAAGAACCCGGACTACGAGAAACACAACCACCTCGAAAACGTCGAACTGCGCTACGAG
ACGATCACCTGGTCGTACAAGGACGGCAACATCATCCACAAGGACACCTGGAACGAGCGTTCCTGA