SecReT6
Protein ID: 238024507
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11100
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1419488..1422196 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5AHX4
KEGG IDbgl:bglu_2g11100
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.50E-40, Aligned region: 242..264
AAA_2 [PF07724], Evalue: 2.50E-40, Aligned region: 619..783
AAA [PF00004], Evalue: 6.70E-19, Aligned region: 244..356
AAA [PF00004], Evalue: 6.70E-19, Aligned region: 624..752
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 244..266
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 342..374
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 623..744
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 790..862
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 115..147
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 221..267
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 289..322
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 506..606
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 592..664
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 687..718
AAA_16 [PF13191], Evalue: 9.20E-10, Aligned region: 756..812
AAA_22 [PF13401], Evalue: 8.70E-08, Aligned region: 243..329
AAA_22 [PF13401], Evalue: 8.70E-08, Aligned region: 622..644
IstB_IS21 [PF01695], Evalue: 9.30E-07, Aligned region: 228..269
IstB_IS21 [PF01695], Evalue: 9.30E-07, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 9.30E-07, Aligned region: 736..762
AAA_25 [PF13481], Evalue: 1.20E-06, Aligned region: 244..266
AAA_25 [PF13481], Evalue: 1.20E-06, Aligned region: 299..330
AAA_25 [PF13481], Evalue: 1.20E-06, Aligned region: 617..643
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 241..266
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 621..645
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 244..378
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 623..658
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 222..264
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 622..637
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 694..705
Sigma54_activat [PF00158], Evalue: 5.30E-05, Aligned region: 226..265
Sigma54_activat [PF00158], Evalue: 5.30E-05, Aligned region: 623..740
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 244..275
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 624..653
NACHT [PF05729], Evalue: 0.00017, Aligned region: 244..271
NACHT [PF05729], Evalue: 0.00017, Aligned region: 623..647
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 238..269
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 622..663
DUF258 [PF03193], Evalue: 0.00033, Aligned region: 230..264
DUF258 [PF03193], Evalue: 0.00033, Aligned region: 622..635
DUF258 [PF03193], Evalue: 0.00033, Aligned region: 746..774
AAA_29 [PF13555], Evalue: 0.00083, Aligned region: 237..260
AAA_29 [PF13555], Evalue: 0.00083, Aligned region: 620..648
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 244..265
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 292..324
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 623..658
Filament [PF00038], Evalue: 0.0014, Aligned region: 454..518
Mg_chelatase [PF01078], Evalue: 0.0032, Aligned region: 238..266
Mg_chelatase [PF01078], Evalue: 0.0032, Aligned region: 623..667
Clp_N [PF02861], Evalue: 0.0045, Aligned region: 24..74
Clp_N [PF02861], Evalue: 0.0045, Aligned region: 112..123
Clp_N [PF02861], Evalue: 0.0045, Aligned region: 475..486
RNA_helicase [PF00910], Evalue: 0.0095, Aligned region: 245..267
RNA_helicase [PF00910], Evalue: 0.0095, Aligned region: 624..644
Protein Sequence: 902 a.a.     [Download]
>gi|238024507|ref|YP_002908739.1| unnamed protein product [Burkholderia glumae BGR1]
MTLRDTTHLLRRLNPHCAKALEAAASLCQGRLSDEITVEHWLLKLIEAGDGDIPAILLHYRIGIDAVWDA
LIAAIERQPRLLRGKPALSPQLAAVLHDAWLHATSEIDEQAIRSGHLLQAIADAPHVLRAQHAWPLLSIS
STQIQRLLPRLGHRSCESQPERVEAGADAEALAAAGEVRPAAAASDGARTPAPRRTVEGDALARFAIDLT
DKARRGDIDPVFGRDREIQQMVDVLARRRKNNPILVGEPGVGKTALVEGLALRVAQANVPNVIREVRILT
LDLGLLQAGAGVKGEFEQRLKNVIDEVQASPVPIMLFIDEAHTLIGAGNAAGGADAANLLKPALARGELR
TIAATTWSEYKEFFERDAALERRFQIIKVDEPDDEAACLMLRGLRSRYAQHHRVHIRDEALVAAVRLSRR
YIPARQLPDKAVDLIDTAAARVRMGLESPPAELQRARAAVSALELEYATLEDDARAGIDNAQARRASLEA
ALASAKSALADLQQRYDTELRLVQALHEQREVEPCARDGASFAQARQALAGAQGKTPLIFADVDAQAIAR
VVAEWTGVPVGNLVEDELQGLLALEAQLARRVVAQDDALAALAESLRTAKAGLRNEHAPLGVFLLAGPSG
VGKTETALALADLLFGGEAALTTINMSEYQESHTVSQLKGSPPGYVGYGRGGILTEAVRQRPYSVVLLDE
VEKAHRDVLDIFYQVFDRGTMRDGEGREIDFRNCVILMTSNLGSAQIDEAITDNPGIAQAALLDAIHPQL
VAHFQPALLARFQTLVYRPLDASALASIMRLKLAKLAGRLRRQHDVELRCDESLIGAMAELCLARESGAR
SVDAFLDQRILPTVSRELLTRMASGLAPAKIALSSSAEGNLTIDFVDRGEPVDAAASEPSGA
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|339717964|ref|NC_012721.2|:1419488-1422196 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGACCCTGCGCGATACGACCCATCTGCTGCGCCGACTCAACCCGCACTGCGCGAAGGCGCTCGAGGCGG
CCGCCAGTCTTTGCCAGGGGAGGCTCTCGGACGAAATTACGGTTGAGCACTGGCTGTTGAAACTGATCGA
GGCCGGCGACGGCGATATTCCGGCGATCCTGCTGCATTACCGGATCGGCATCGATGCCGTCTGGGACGCG
TTGATTGCCGCGATCGAACGCCAGCCCCGCCTCCTGCGGGGCAAGCCGGCGCTCTCGCCGCAGCTGGCGG
CCGTGCTTCACGACGCGTGGCTTCACGCCACGTCGGAGATCGACGAGCAGGCCATCCGGTCTGGCCACTT
GCTGCAGGCCATCGCCGACGCGCCGCACGTGCTGCGCGCGCAGCATGCCTGGCCGCTGCTGTCGATCAGC
AGCACGCAGATCCAGCGGCTGCTACCGCGTCTCGGTCATCGGTCGTGCGAAAGCCAGCCGGAGCGCGTGG
AAGCTGGAGCGGATGCCGAGGCGCTCGCCGCGGCTGGTGAAGTCCGGCCGGCAGCCGCCGCGAGCGACGG
CGCTCGAACGCCCGCGCCTCGGCGGACCGTCGAGGGCGACGCGCTTGCGCGCTTCGCGATCGATCTGACC
GACAAGGCGCGCCGCGGCGACATCGATCCCGTCTTCGGCCGCGATCGCGAGATCCAGCAGATGGTCGACG
TGCTCGCGCGCCGGCGCAAGAACAATCCGATTCTCGTCGGCGAACCGGGCGTGGGCAAAACCGCGCTCGT
CGAAGGTCTCGCGTTGCGCGTGGCGCAAGCCAACGTCCCGAACGTGATCCGCGAGGTGCGTATCCTGACG
CTCGACCTGGGCCTGCTGCAGGCCGGCGCCGGCGTGAAGGGGGAGTTCGAGCAGCGCCTGAAGAACGTCA
TTGACGAAGTGCAGGCCTCGCCCGTGCCGATCATGCTCTTCATCGACGAAGCGCACACGCTGATCGGCGC
GGGCAATGCCGCCGGCGGCGCGGATGCCGCGAACCTGCTCAAGCCGGCGCTTGCGCGCGGCGAGCTGCGC
ACGATCGCGGCCACCACGTGGTCCGAATACAAGGAATTCTTCGAGCGTGACGCCGCGCTCGAGCGCCGTT
TCCAGATCATCAAGGTCGACGAGCCCGACGATGAAGCGGCATGCCTGATGCTGCGAGGCCTCAGGAGCCG
CTACGCGCAACATCACCGCGTCCACATCCGCGACGAGGCGCTCGTCGCCGCGGTGAGGCTGTCGCGTCGC
TATATTCCCGCACGGCAGCTACCCGACAAGGCAGTCGACCTGATCGACACGGCGGCCGCGCGCGTACGCA
TGGGTCTGGAGTCGCCGCCAGCGGAACTGCAGCGGGCGCGGGCCGCCGTGTCGGCGCTCGAGCTGGAGTA
TGCGACGCTGGAAGACGATGCACGCGCAGGCATCGATAACGCGCAGGCGCGCCGCGCCTCGCTCGAGGCA
GCGCTCGCGAGCGCAAAGTCTGCCCTGGCCGATCTGCAGCAGCGTTATGACACGGAGCTCCGGCTCGTTC
AGGCATTGCACGAGCAGCGTGAGGTCGAGCCGTGCGCCCGCGACGGCGCCTCGTTCGCACAGGCGCGACA
GGCGCTCGCCGGCGCCCAGGGAAAAACGCCGCTGATCTTCGCCGATGTGGATGCGCAGGCGATCGCGCGC
GTCGTCGCCGAGTGGACGGGCGTGCCCGTCGGCAACCTCGTCGAGGACGAGCTGCAAGGCCTGCTTGCGC
TCGAGGCACAGCTCGCAAGGCGTGTGGTCGCCCAGGACGATGCCCTCGCCGCGCTCGCCGAGAGCCTGCG
CACCGCGAAGGCGGGGCTCAGGAACGAGCATGCGCCGCTCGGCGTGTTCCTGCTTGCCGGCCCCTCTGGC
GTGGGCAAGACCGAAACCGCCCTGGCCCTGGCCGACCTCCTGTTCGGGGGCGAGGCCGCGCTCACGACGA
TCAATATGTCGGAGTACCAGGAATCGCATACGGTGTCACAGTTGAAAGGCTCGCCGCCGGGCTACGTCGG
ATATGGCCGTGGCGGGATTCTGACCGAGGCGGTGCGCCAGCGCCCATATAGCGTCGTGCTGCTCGACGAG
GTCGAGAAGGCCCACCGCGACGTGCTGGACATCTTTTACCAGGTGTTCGATCGCGGCACGATGCGCGACG
GCGAGGGGCGCGAGATCGACTTCCGCAACTGCGTGATCCTGATGACGTCCAATCTCGGCAGCGCGCAGAT
CGACGAGGCGATCACCGACAATCCCGGGATTGCGCAGGCCGCGCTGCTCGATGCCATTCATCCGCAACTC
GTCGCGCACTTCCAGCCCGCCCTGCTCGCCCGCTTCCAGACGCTCGTGTACCGGCCGCTGGACGCATCCG
CGCTCGCCTCCATCATGCGCCTGAAGCTCGCCAAGCTTGCAGGCCGCCTGCGCCGTCAGCACGATGTCGA
ACTGAGGTGCGACGAGTCGCTGATCGGCGCGATGGCCGAGCTGTGTCTCGCTCGCGAATCCGGCGCACGC
AGCGTCGACGCCTTCCTCGACCAGCGCATCCTGCCTACGGTGTCGCGCGAGTTGCTGACTCGCATGGCCA
GCGGCCTCGCGCCGGCGAAGATCGCGCTGTCGAGTTCGGCCGAGGGCAACCTCACGATCGACTTCGTCGA
TCGCGGCGAACCGGTGGACGCCGCAGCCAGCGAGCCGTCCGGCGCCTGA