SecReT6
Protein ID: 238024508
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g11110
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1422210..1422638 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC5AHX5
KEGG IDbgl:bglu_2g11110
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-18, Aligned region: 32..115
Protein Sequence: 142 a.a.     [Download]
>gi|238024508|ref|YP_002908740.1| unnamed protein product [Burkholderia glumae BGR1]
MPAGPSLYDMLLGQIGGEPLAAYDDRTLECMSVQQNVQRILNTRAGTLKHLPDYGLPDLTNIYKALPASA
HLLKEQMEATLLRYEPRIRSIDVEILDNDDPGVLVSFEMSCHLKKAGLVRFGTYFEPPGRMRVKRQQTKS
GG
 
Nucleotide Sequence: 429 bp     [Download]
>gi|339717964|ref|NC_012721.2|:1422210-1422638 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGCCGGCGGGCCCCTCTCTCTACGACATGCTGCTCGGCCAGATCGGGGGGGAACCGCTGGCCGCGTATG
ACGACCGGACGCTCGAATGCATGAGCGTGCAGCAGAACGTCCAGCGCATCCTGAACACGCGCGCCGGCAC
GTTGAAGCACCTGCCCGACTACGGGCTGCCGGACCTGACGAACATCTACAAGGCCTTGCCCGCCTCCGCC
CACCTGCTCAAGGAGCAGATGGAGGCCACGCTGCTCAGGTACGAGCCACGCATCCGGTCAATCGACGTCG
AGATCCTCGACAACGACGATCCCGGCGTGCTCGTGAGCTTCGAGATGAGCTGTCACCTGAAGAAGGCCGG
ATTGGTCCGGTTCGGCACGTACTTCGAGCCGCCCGGGCGCATGCGCGTGAAACGGCAACAGACGAAATCC
GGCGGCTGA