SecReT6
Protein ID: 238026057
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03850
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]397352..398143 [-]
ProductOmpA family protein
NoteTssL
UniProt IDC5AA61
KEGG IDbgl:bglu_1g03850
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-57, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|238026057|ref|YP_002910288.1| unnamed protein product [Burkholderia glumae BGR1]
MSYAPSLFGGNTPPPSSAPHSASSTDASFQARSLLDLLYDGFFMMFLLKNGREPGEANEFRGRIQEFLAD
FERGAKKLNVGADDVYAAKFAFCAAIDEAVLSSQFKVRAEWEQRPLQLVLFGEQLAGEKFFQYLEECRAR
GAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIAQMKGKRAPFAPHWALPDQIAHRLKREV
PLWAIGAVFALVGLLAFIGLNTYLRDHTLKALAPYSQIIKVGPESANLTISLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|339905954|ref|NC_012724.2|:c398143-397352 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGAGCTACGCGCCCTCCCTGTTCGGCGGCAACACGCCGCCGCCTTCCTCCGCCCCGCACTCGGCCTCGT
CGACCGACGCCAGCTTCCAGGCGCGTTCGCTGCTCGACCTGCTGTACGACGGCTTCTTCATGATGTTCCT
GCTGAAGAACGGCCGCGAGCCCGGCGAGGCCAACGAATTCCGCGGGCGAATCCAGGAGTTCCTCGCCGAT
TTCGAGCGCGGCGCGAAAAAGCTCAACGTCGGCGCCGACGATGTGTACGCCGCCAAGTTCGCGTTCTGCG
CCGCGATCGACGAGGCCGTGCTGTCGTCGCAGTTCAAGGTGCGCGCCGAATGGGAGCAGCGGCCGCTGCA
GCTCGTGCTGTTCGGCGAGCAGCTGGCCGGCGAGAAGTTCTTCCAGTATCTCGAGGAATGCCGCGCGCGC
GGCGCCGCGCGCCTGCAGTCGCTCGAGGTGTTCCACATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTACC
TGCTCGAAGGGCCCGAGAAGCTCGCCTACCTGACCGCGCGGATCGGCGACGAGATCGCGCAGATGAAGGG
CAAGCGCGCGCCGTTCGCGCCACACTGGGCGCTGCCCGACCAGATCGCGCACCGCCTGAAGCGCGAGGTG
CCGCTGTGGGCCATCGGCGCCGTGTTCGCGCTGGTGGGGCTGCTCGCGTTCATCGGGCTCAATACCTACC
TGCGCGACCATACGCTGAAGGCGCTCGCGCCGTACTCGCAGATCATCAAGGTCGGACCGGAATCGGCGAA
CCTGACGATTTCGCTGCCTTGA