SecReT6
Protein ID: 238026058
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03860
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]398140..399486 [-]
Producttype VI secretion system protein TssK
NoteTssK
UniProt IDC5AA62
KEGG IDbgl:bglu_1g03860
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|238026058|ref|YP_002910289.1| unnamed protein product [Burkholderia glumae BGR1]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESVQAIQPYNWGVRSVKLDRDAISSNVLRLSELSLIFP
DGALYSAPQADDLPPPVALDTLPEGINEFTFYLALHPLRETGSNYVEDADGGFTSRFTSENNPISDQFTD
AAEADITFLKTNVKLIAHSEPRDQLLAIPLVRVRRTATSGFEFDDTFVPPCLAIEASGILMQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFASLAHLYQHCALHPERLFQELLRLAGQLMT
FSKSYALADLPAYRHDDPGPPFARLDTMLRELLETVISTRYFAITLEEVRPSFHIGRLDSGKIDDKTEFY
LAVSADMASVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQSQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|339905954|ref|NC_012724.2|:c399486-398140 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTATGGGGTGAAGGCCTGTTTCTGCGGCCTCAGCACTTTCAACGTCAGG
ACGCCTACCACGAGGCACGCCTGTTCGAGTCGGTGCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGAAGCTGGACCGCGACGCGATCAGCAGCAACGTGCTGCGGCTCTCGGAGCTGTCGCTGATCTTCCCC
GACGGCGCGCTGTATTCCGCGCCGCAGGCCGACGACCTGCCGCCGCCCGTCGCGCTCGATACGCTGCCCG
AGGGCATCAACGAGTTCACGTTCTATCTCGCACTGCATCCGCTGCGCGAAACCGGGTCGAACTACGTGGA
GGACGCCGACGGCGGCTTCACGAGCCGCTTCACGAGCGAGAACAACCCGATCTCCGACCAGTTCACCGAC
GCGGCCGAGGCCGACATCACGTTCCTCAAGACCAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGGCGATTCCGCTCGTGCGCGTGCGCCGTACCGCCACCTCCGGCTTCGAGTTCGACGACACCTT
CGTGCCGCCGTGCCTGGCCATCGAGGCCTCCGGGATCCTGATGCAGCGGCTGCGCCAGCTGATCGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTACGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAGTTCCGCT
CCGGCGACATCGCCTCGTTCTGGCTGCTGCACACCGCCAACGCCGCGTTCGCCTCGCTCGCGCACCTGTA
CCAGCATTGCGCGCTGCATCCCGAGCGGCTGTTCCAGGAGCTGCTGCGCCTGGCCGGCCAGCTGATGACG
TTCTCGAAGTCCTACGCACTCGCCGACCTGCCCGCCTATCGCCACGACGATCCCGGCCCGCCGTTCGCGC
GCCTCGACACCATGCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCACATCGGCCGGCTCGACTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTCGCCGTGTCGGCCGACATGGCGTCGGTGGAACTGGTGGACGCCGTGCCCGCGCGCTTCAAGGTCGGCG
CGCCCGACGACGTCGACAAGCTGGTGCTGTCCGCGATGCCGGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCCGGCGCCTGCTACTTCGCGCTCGACGCGCGCAGCCCGCTCTATGAG
CGCATGCTGCAGTCGCAGTCGGCGATGATCTACGCGCCGTCGGGCATCAACGACCTCAAATTCGAACTGA
TCGCCGTCACATCATGA