SecReT6
Protein ID: 238026059
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03870
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]399588..400205 [-]
Producttype VI secretion system protein TssJ
NoteTssJ
UniProt IDC5AA63
KEGG IDbgl:bglu_1g03870
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-37, Aligned region: 15..176
Protein Sequence: 205 a.a.     [Download]
>gi|238026059|ref|YP_002910290.1| unnamed protein product [Burkholderia glumae BGR1]
MTPFLSRFALPLAACALLAGCAAAVPLLGSAGSAALQMVGIGKPDVPDAQKPPRNLAVTLYAAPNLNAAN
DNRPLALVVRLYTLKDPTSFMQAPFDAFTDPAKEKATLGADLLSVREVTLIPGQHYNATEKVSREAQAFG
VVALFRSPALQRWKLAFDPAKSEKSGIIIGLHNCAMTVTGGNVIAPQQGMPAQQLNMLSSVSCGG
 
Nucleotide Sequence: 618 bp     [Download]
>gi|339905954|ref|NC_012724.2|:c400205-399588 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGACTCCGTTTCTCTCCCGCTTCGCGCTGCCGCTCGCGGCCTGCGCGCTTCTGGCAGGCTGCGCGGCGG
CGGTGCCGCTGCTCGGTTCGGCAGGCAGCGCCGCGCTGCAGATGGTCGGCATCGGCAAGCCCGATGTGCC
CGACGCGCAGAAGCCGCCGCGCAATCTGGCCGTGACCCTCTACGCCGCGCCGAACCTGAACGCCGCCAAC
GACAACCGGCCGCTCGCATTAGTAGTAAGGCTCTACACGCTGAAGGATCCGACCTCGTTCATGCAGGCAC
CGTTCGACGCGTTCACCGATCCCGCCAAGGAGAAGGCCACGCTCGGCGCCGACCTGCTCAGCGTGCGCGA
GGTGACGCTGATTCCGGGGCAGCACTACAACGCCACCGAGAAGGTCTCGCGCGAGGCGCAGGCGTTCGGC
GTCGTCGCGCTGTTTCGCTCGCCCGCGCTGCAACGCTGGAAGCTGGCATTCGATCCGGCGAAATCGGAGA
AATCCGGCATAATCATCGGCCTGCACAACTGCGCGATGACGGTGACGGGCGGTAACGTGATCGCGCCGCA
GCAGGGCATGCCGGCGCAGCAGCTCAATATGCTGTCGTCGGTCAGCTGCGGCGGCTGA