SecReT6
Protein ID: 238026061
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03890
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]401263..401802 [+]
Producttype VI secretion system protein TssB
NoteTssB
UniProt IDC5AA65
KEGG IDbgl:bglu_1g03890
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-58, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|238026061|ref|YP_002910292.1| unnamed protein product [Burkholderia glumae BGR1]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVGDLAGQSEVEMPKLRDRKFVNIDRDNF
DDVMKAIEPRAAYQVENKLSEDGGKFAVDLKFRSLDDFDPDQVVNQIEPLRRLIEARSKLADLRNKMAGN
DKLEDLLSEVLSNTQQLEALAKQSGEADGKPDDGKNSGE
 
Nucleotide Sequence: 540 bp     [Download]
>gi|339905954|ref|NC_012724.2|:401263-401802 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGGCAAAAAAAGAAAGTATCCAGAAACGCCTGCAAAAGGTGCGGCCGCCCCGCGTGCAGCTCACCTACG
AGGTCGAGCGCGGCGATGCGATCGAGGTGAAGGAACTGCCGTTCGTGGTCGGCGTGGTCGGCGACCTGGC
CGGGCAGTCCGAGGTCGAGATGCCGAAGCTGCGTGACCGCAAGTTCGTCAACATCGATCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCGGCCTACCAGGTCGAGAACAAGCTCAGCGAGGACGGCG
GCAAGTTCGCGGTGGACCTGAAGTTCCGCTCGCTCGACGATTTCGATCCGGACCAGGTGGTCAACCAGAT
CGAGCCGCTGCGCCGCCTGATCGAGGCGCGCTCGAAGCTGGCCGACCTGCGCAACAAGATGGCCGGCAAC
GACAAGCTCGAGGATCTCCTGAGCGAGGTGCTCAGCAACACGCAGCAGCTCGAGGCGCTCGCCAAGCAAT
CGGGCGAGGCGGACGGCAAGCCGGACGACGGCAAGAACAGCGGCGAATGA