SecReT6
Protein ID: 238026062
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03900
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]401817..403307 [+]
Producttype VI secretion system protein TssC
NoteTssC
UniProt IDC5AA66
KEGG IDbgl:bglu_1g03900
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|238026062|ref|YP_002910293.1| unnamed protein product [Burkholderia glumae BGR1]
MNQQTAAAQQSGALEGAETSLLDEIVEKSKVAKSQSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISAQMSAVMHAPEFQRLESTWRGLDYLVSESNTGSTIKIKAMHAPKRELVRDFKAATEFDQSA
LFKKVYEEEFGTFGGAPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASAAPELIGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFHPKDGQIAESFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYNTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ESFLNRWISQYVLLDDNATQEQKAQFPLREASVQVAEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKSANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|339905954|ref|NC_012724.2|:401817-403307 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAGCAGTCCGGTGCCCTCGAAGGCGCCGAAACATCGCTTCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCCAAATCGCAGTCCGAGCACGCACGTGCGAAGGACCTGATCGGCGA
ACTCGTGCATCAGGTGCTCGACGGCACCGTGATCGTCTCGGACAATCTGTCGGCCACCATCGACGCGCGC
GTGGCCGAGCTCGACCGGCTGATCTCGGCGCAGATGAGCGCGGTGATGCACGCGCCCGAATTCCAGCGCC
TCGAAAGCACCTGGCGCGGCCTCGACTATCTGGTCTCGGAGAGCAACACCGGCTCGACCATCAAGATCAA
GGCGATGCACGCGCCCAAGCGCGAGCTGGTGCGCGACTTCAAGGCCGCCACCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGCGCGCCGTTCGGCGCGCTGATCGGCG
ACTACGAGATCTCGCGCCAGCCCGAGGACATGTACTTCATCGAGCAGATGTCGCACGTGGCGGCCGCCGC
GCACGCGCCGTTCATCGCCTCGGCCGCGCCCGAGCTGATCGGCCTCGAGTCGTTCGCCGACCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACCGTCGAATACGCGAAGTGGAAATCGTTCCGCGACTCGGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGTTTCCTCGGCCGCCTGCCGTTCCATCCCAAGGACGGCCA
GATCGCCGAGAGCTTCAATTTCGTCGAGGACGTCGACGGCACCGATCATTCGAAATATCTGTGGTGCAAC
GCCGCCTGGGCGTTCGCGGCGCGCCTGACCGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTGGAGGGCGGCGGCCTGGTCGAGGATCTGCCCACCCATACCTTCAAGACCGACGACGGCGAGATCGC
GCTGAAGTGCCCCACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCCGACTACGCTGCCTTCTTCGCCGCCCAGTCGGTGCAGAAGCCCAAGA
AATACAACACCGACAGCGCGAACGCGAACGCGGTGCTGTCCGCTCAGCTCCAGTACATCTTCTCGGTATC
GCGCATCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCCTCCGCGCAGAACGTG
GAATCTTTCCTGAATCGCTGGATCTCCCAGTACGTGCTGCTGGACGACAACGCGACGCAGGAACAGAAAG
CGCAGTTTCCGCTGCGCGAAGCTTCGGTCCAGGTGGCCGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGGCCGCACTTCCAGCTCGACGAACTCTCGATCTCGCTGCGCCTGGTCGCGGATCTG
CCCAAGTCGGCAAATTCATGA