SecReT6
Protein ID: 238026064
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03920
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]403965..404447 [+]
Producttype VI secretion system protein TssE
NoteTssE
UniProt IDC5AA68
KEGG IDbgl:bglu_1g03920
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-21, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|238026064|ref|YP_002910295.1| unnamed protein product [Burkholderia glumae BGR1]
MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKNTVARDVESILNTRIALTDEDLAALPQCQQSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIDRHEPRLRQVAVSFELNEQSTNSLNFVIRGLLVVHPAQEPVSFD
AMLQPSTLQYSVTRGRAAKT
 
Nucleotide Sequence: 483 bp     [Download]
>gi|339905954|ref|NC_012724.2|:403965-404447 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGAAACGTTTCGAGCCGAGTTTCCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGCCAG
CGATGCGGCAGTTGTCGTTGGACGAACTGAAGAACACCGTGGCCCGTGACGTCGAATCGATCCTGAACAC
GCGCATCGCGCTGACGGACGAAGACCTCGCGGCGCTGCCGCAGTGCCAGCAGTCGGTGCTGACCTATGGA
CTCAACGACTTCGCGGGCCTGAGCCTGGCGAGTCACTACGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCGATCGACCGGCACGAGCCGCGCTTGCGCCAGGTGGCGGTATCGTTCGAACTCAACGAGCAATCGAC
CAACTCGTTGAACTTCGTGATCCGGGGGCTGCTGGTCGTGCATCCGGCGCAGGAGCCCGTCAGTTTCGAC
GCGATGCTGCAGCCGTCCACCCTGCAGTATTCGGTGACGCGCGGCCGCGCCGCCAAGACATAA