SecReT6
Protein ID: 238026065
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03930
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]404540..406378 [+]
Producttype VI secretion system protein TssF
NoteTssF
UniProt IDC5AA69
KEGG IDbgl:bglu_1g03930
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-214, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|238026065|ref|YP_002910296.1| unnamed protein product [Burkholderia glumae BGR1]
MEELLPYYERELSFLRRYSHEFARRYPKIAARLAMTGEHCDDPHVERMIESFALLGARINKKLDDDYPEF
TEALVDVLYPHYLRPFPSCTIAQFTPTPAISQLTAPHRVARGTELKSRAIRGVQCQFRTAYDVTIAPIRI
SEARYSSIAVAPAATVLPGNATGVISITFESLAPQFDLGALGLDTLRAHLHGEQSFVAALADCLFINTLA
TYVEPERNGRWTALRRSPVTQAGFGEEDALIDYPARSHPAYRLLTEYFAFPDKFDFVDFDLAAMARRAGP
CHRLTLHVVLSDVRSDSHVARLLDMLSATHLRLFCTPVVNLFKQNGEPIRVDHQSVSYPVIAEARRAFAY
EVYSIDSVHLVRQTAHEEAVVEFRPFYSLHHGEAGHVGHYWFARRNEWVAQHSPGYETELSIVDIDFEPA
APQTDTLSLRLTCTNRDLPAGLATGLAGGDLFADGGADFGDITMLRRPTASVRFARGRAAHWRLISHLAL
NHVSLVADGLAPLKELLTLYDLRRSAVSMRHIDGLVAIEQRGSVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLAAFARMLDVFFGLYVHLNSFVQLIVVSKRTGEEIMRCQPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|339905954|ref|NC_012724.2|:404540-406378 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGGAAGAGCTGCTGCCGTACTACGAGCGCGAACTGTCGTTTCTGCGGCGCTACTCGCACGAATTCGCGC
GGCGCTATCCGAAGATCGCGGCACGGCTCGCGATGACGGGCGAGCATTGCGACGACCCGCACGTCGAGCG
CATGATCGAATCGTTCGCGCTGCTGGGCGCGCGCATCAACAAGAAGCTCGACGACGACTATCCGGAATTC
ACCGAGGCGCTCGTCGATGTGCTCTATCCGCACTACCTGCGGCCGTTCCCGTCCTGCACCATCGCGCAGT
TCACGCCCACCCCGGCGATCTCGCAGTTGACCGCGCCGCATCGCGTGGCGCGCGGCACCGAGCTGAAGAG
CCGCGCGATCCGCGGCGTGCAGTGCCAGTTCCGCACCGCCTATGACGTGACGATCGCGCCGATCCGCATC
AGCGAGGCGCGCTATTCGTCGATCGCCGTCGCGCCGGCCGCCACCGTGCTGCCCGGCAACGCCACCGGCG
TGATCTCGATCACCTTCGAGTCGCTCGCGCCGCAGTTCGACCTCGGCGCGCTGGGGCTCGACACGCTGCG
CGCGCACCTGCACGGCGAGCAGTCGTTCGTGGCCGCGCTGGCCGACTGCCTGTTCATCAACACGCTGGCC
ACCTACGTCGAGCCCGAGCGCAACGGCCGCTGGACGGCATTGCGCCGTTCGCCCGTGACGCAGGCCGGCT
TCGGCGAAGAGGACGCGCTGATCGACTACCCGGCGCGCTCGCATCCGGCCTACCGGCTGCTGACCGAATA
CTTCGCGTTTCCCGACAAGTTCGATTTCGTCGATTTCGACCTGGCCGCGATGGCGCGCCGCGCGGGGCCG
TGCCACCGCCTGACGCTGCACGTCGTGCTCAGCGACGTGCGCAGCGATTCGCACGTGGCGCGCCTGCTCG
ACATGCTGAGCGCCACCCACCTGCGCCTGTTCTGCACGCCGGTGGTGAACCTGTTCAAGCAGAACGGCGA
GCCGATCCGCGTCGATCACCAGAGCGTGTCGTACCCGGTGATCGCCGAGGCGCGCCGCGCGTTCGCCTAC
GAGGTCTATTCGATCGACTCGGTGCATCTGGTGCGCCAGACCGCGCACGAGGAGGCGGTGGTGGAGTTCC
GGCCGTTCTACTCGCTGCATCACGGCGAGGCCGGCCATGTCGGCCACTACTGGTTCGCGCGCCGCAACGA
GTGGGTCGCGCAGCACAGCCCCGGCTACGAGACCGAGCTGTCGATCGTCGACATCGATTTCGAGCCGGCC
GCGCCGCAGACCGACACGCTGAGCCTGCGCCTGACCTGCACCAACCGCGATCTGCCGGCGGGGCTCGCCA
CCGGCCTGGCCGGCGGCGACCTGTTCGCCGACGGCGGCGCCGATTTCGGCGACATCACGATGCTGCGCCG
GCCCACGGCGAGCGTGCGCTTCGCGCGCGGGCGCGCCGCGCACTGGCGGCTGATCTCGCATCTCGCGCTG
AACCACGTCTCGCTGGTGGCCGACGGCCTCGCGCCGCTCAAGGAACTGCTCACGCTCTACGATCTGCGCC
GCTCGGCGGTCTCGATGCGCCACATCGACGGGCTGGTCGCGATCGAGCAGCGCGGCTCCGTGCAGTGGCT
GCCCGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATTCGCCTGACGATCGACGAGGAACACTTC
GTCGGCACCAGCCTCGCCGCATTCGCGCGCATGCTCGACGTGTTCTTCGGGCTGTACGTCCACCTCAACA
GCTTTGTGCAACTGATCGTCGTGTCCAAGCGCACCGGCGAGGAGATCATGCGATGCCAACCGCGAAGCGG
CGAATCGATCCTGGCGTAG