SecReT6
Protein ID: 238026066
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03940
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]406342..407439 [+]
Producttype VI secretion system protein TssG
NoteTssG
UniProt IDC5AA70
KEGG IDbgl:bglu_1g03940
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.30E-91, Aligned region: 18..346
Protein Sequence: 365 a.a.     [Download]
>gi|238026066|ref|YP_002910297.1| unnamed protein product [Burkholderia glumae BGR1]
MPTAKRRIDPGVVGQFLDEPYRFEFFQAVRLLETWFARRDPEKPDALRPGEIVERRLAFRNSLSLGFPPS
EIEEAQSFDAAGEHVAEEARAAAIGSEAIDRVSIMPAFFGLLGGQGALPHHYTEQVVAREHLKRDHAARA
FFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSHRGARRAMQEGTGAVIDEAIAGYAL
AARHRPVSAAYLQRTLSDYFQVTIGVEQFVGKWYDVPPDQLSVLGEINATLGATALVGERVWQRDMRARL
VVGPLSKRDYEAFLPGGDCAVALERMLTLVAGVTLEYEVRLVLKRAEVGPTILNNGGRLGWDAFLCTQEA
RHDRADARYELHVIH
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|339905954|ref|NC_012724.2|:406342-407439 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGCCAACCGCGAAGCGGCGAATCGATCCTGGCGTAGTCGGGCAATTCCTCGACGAGCCGTATCGCTTCG
AGTTCTTCCAGGCGGTGCGCTTGCTCGAAACCTGGTTCGCGCGGCGTGATCCGGAGAAGCCCGACGCGCT
GCGGCCCGGCGAGATCGTCGAGCGGCGCCTGGCGTTCCGCAATTCGCTGTCGCTCGGCTTCCCGCCGAGC
GAGATCGAGGAGGCGCAGTCGTTCGACGCGGCCGGCGAGCACGTGGCCGAGGAGGCGCGCGCGGCCGCGA
TCGGCAGCGAGGCGATCGACCGCGTGTCGATCATGCCGGCGTTCTTCGGCCTGCTGGGCGGCCAGGGCGC
GCTGCCGCATCACTACACCGAGCAGGTGGTGGCGCGCGAGCACCTGAAGCGCGACCACGCGGCGCGCGCG
TTCTTCGACGTGTTCTCGAACCGCGCCACCGCGCTGTTCTATTCGGCGTGGAAGAAGTACCGGCTGCCGC
TGCATTACGAACTCGACCGCGACGAGCGCTACCTGCCGCTGCTGCTCGCGCTGGCCGGCGTGTCGCACCG
CGGCGCGCGGCGAGCGATGCAGGAAGGCACCGGCGCGGTGATCGACGAGGCGATCGCCGGCTACGCGCTG
GCCGCGCGGCACCGGCCCGTGTCGGCCGCCTATCTGCAGCGCACGCTGTCGGACTACTTCCAGGTGACGA
TCGGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGACCAGCTGAGCGTGCTCGGCGAGAT
CAACGCCACGCTCGGCGCCACCGCGCTGGTGGGCGAGCGCGTCTGGCAGCGCGACATGCGCGCGAGGCTG
GTGGTTGGCCCGCTCTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGACTGCGCGGTCGCGCTGG
AGCGGATGCTGACGCTGGTGGCCGGCGTCACGCTCGAATACGAGGTCCGGCTGGTGCTCAAGCGCGCCGA
GGTCGGCCCGACCATCCTCAACAACGGCGGGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCAGGAGGCG
CGGCACGACCGCGCCGACGCGCGCTACGAACTGCACGTGATCCACTGA