SecReT6
Protein ID: 238026067
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03950
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]407505..410174 [+]
Producttype VI secretion system protein TssH
NoteTssH
UniProt IDC5AA71
KEGG IDbgl:bglu_1g03950
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.00E-44, Aligned region: 232..323
AAA_2 [PF07724], Evalue: 5.00E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 232..345
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 624..708
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 623..744
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 569..587
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 794..869
Clp_N [PF02861], Evalue: 2.10E-11, Aligned region: 25..74
Clp_N [PF02861], Evalue: 2.10E-11, Aligned region: 113..133
Clp_N [PF02861], Evalue: 2.10E-11, Aligned region: 400..411
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 23..56
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 209..255
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 604..644
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 689..711
AAA_16 [PF13191], Evalue: 1.70E-08, Aligned region: 789..860
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 350..390
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 2.80E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 2.80E-06, Aligned region: 621..740
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 233..281
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 469..469
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 623..659
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 806..834
AAA_29 [PF13555], Evalue: 6.90E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 6.90E-05, Aligned region: 619..649
AAA_29 [PF13555], Evalue: 6.90E-05, Aligned region: 721..751
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 374..460
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 624..644
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 223..253
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 798..834
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 432..458
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 619..645
Zeta_toxin [PF06414], Evalue: 0.0009, Aligned region: 231..251
Zeta_toxin [PF06414], Evalue: 0.0009, Aligned region: 615..663
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 234..365
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 621..704
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 622..655
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 284..330
Arch_ATPase [PF01637], Evalue: 0.006, Aligned region: 620..662
Protein Sequence: 889 a.a.     [Download]
>gi|238026067|ref|YP_002910298.1| unnamed protein product [Burkholderia glumae BGR1]
MSTPLKTLIAKLNPTCRKAAERAASQCLARGHYEVDLEHLFVALLDETSGDMPVVLRASGVDPHALRRDL
ERELDTLKSGNTRTPVFSVHLSELFQQAWLIASLDAQIGRIRSGHLLLALLSAPDLAQFAQRMSPQFAQV
RVTDLKHKFDEITAGSHEAEPRGAEAGHDGAPEAAALAGAAGGPSKTPALDTYTTNLTQRARDGKIDPVI
GRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAAADVPPPLAGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKQSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAQSATPAAIDDLKKRLERTAAEIAALEREVAGGAAHDERLAALGAARDADLAALAAAE
ARYAEEQAIVAEIVALRAQIDASREASADGERIDADAVRAQLAERVAALKAVQGGEPMVPLQVDAHVVAE
IVAAWTGIPLGRMVKDEIETVMNLKALLGARVIGQDHALDAVAQRVRTATAGLEDPNKPRGVFLFVGPSG
VGKTETALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
IEKAHPDVLEMFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSAVMQACLNQPAEALPDPDALAETLR
PALYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIARRIEANHKARFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLERLAEGSAIERIAVRASEAGEFEYTVK
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|339905954|ref|NC_012724.2|:407505-410174 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGAGCACGCCCCTCAAAACCCTGATTGCCAAACTGAATCCCACCTGCCGCAAGGCGGCCGAACGCGCGG
CCAGCCAGTGCCTCGCGCGCGGCCACTACGAGGTCGATCTCGAGCACCTGTTCGTGGCGCTGCTCGACGA
GACCTCGGGCGACATGCCGGTGGTGCTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCCGCGACCTC
GAGCGCGAGCTCGACACGCTCAAGAGCGGCAACACGCGCACGCCGGTGTTCTCGGTGCATCTGAGCGAGC
TGTTCCAGCAGGCCTGGCTGATTGCCTCGCTCGATGCGCAGATCGGCCGGATCCGTTCCGGGCACCTGCT
GCTCGCGCTGCTGAGCGCGCCGGACCTCGCGCAGTTCGCGCAGCGCATGTCGCCGCAGTTCGCGCAGGTG
CGCGTGACCGATCTGAAGCACAAGTTCGACGAGATCACGGCCGGCTCCCACGAGGCCGAGCCGCGCGGCG
CCGAGGCCGGGCACGACGGCGCGCCCGAGGCCGCCGCGCTGGCCGGTGCCGCGGGCGGCCCGTCGAAGAC
GCCCGCGCTCGACACCTACACCACCAACCTCACGCAGCGCGCGCGCGACGGCAAGATCGATCCGGTGATC
GGCCGCGACGCCGAGATCCGCCAGGCGATCGACATCCTGATGCGGCGCCGCCAGAACAACCCGATCATGA
CCGGCGAGGCCGGCGTCGGGAAGACCGCCGTGGTGGAAGGGCTGGCGCTGCGGATCGCCGCGGCCGACGT
GCCGCCGCCGCTCGCGGGCGTGGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAGCGTGATCGACGAGGTCAAGCAGAGCCCGCATCCGATCATCC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCCGGCGGCCAGGCCGGCCAGAACGACGCGGCCAACCT
GCTCAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACCATCGCGGCCACCACCTGGAGCGAGTACAAGAAA
TACTTCGAGAAGGATGCGGCGCTCGCGCGGCGCTTCCAGGTGGTCAAGATCGAGGAGCCGAGCGAGCCGC
TGGCCGCCGCGATGCTGCGCGGCATGGCCGCGCTGATGGAGCGCCACTTCAACGTGCGGATTCTCGACGA
CGCGATCACCGAGGCGGTGCGCCTGTCGCATCGCTACATCAGCGGCCGGCAGCTGCCGGACAAGGCGATC
AGCGTGCTCGATACGGCCTGCGCGAAGGTCGCGCTGGCGCAGAGCGCGACGCCGGCGGCCATCGACGACC
TGAAGAAGCGCCTGGAGCGCACCGCCGCCGAGATCGCCGCGCTCGAGCGCGAGGTGGCGGGCGGGGCCGC
GCACGACGAGCGCCTCGCCGCGCTCGGCGCGGCGCGCGACGCCGATCTGGCCGCGCTGGCGGCGGCCGAG
GCGCGCTATGCCGAGGAGCAGGCGATCGTCGCCGAGATCGTCGCGCTGCGCGCGCAGATCGATGCCTCGC
GCGAGGCATCGGCCGACGGCGAGCGGATCGACGCCGACGCGGTGCGCGCCCAGCTGGCCGAGCGCGTGGC
CGCGCTGAAGGCGGTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTGGACGCGCACGTGGTGGCCGAG
ATCGTCGCCGCGTGGACCGGCATCCCGCTCGGCCGCATGGTCAAGGACGAGATCGAGACCGTGATGAACC
TGAAGGCGCTGCTCGGCGCGCGCGTGATCGGTCAGGACCACGCGCTCGACGCGGTGGCGCAGCGCGTGCG
CACCGCGACCGCCGGCCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACCGCGCTCGCGCTGGCCGACGTGCTGTACGGCGGCGAGCGCAAGATGGTCACCA
TCAACATGAGCGAGTACCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGTCGG
CTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGCAACCCGTATTCGGTGGTGCTGCTCGACGAG
ATCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCGTGATGGACGATG
CCGAGGGCCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACCTCGAACGTCGGCTCGTCGGCGGT
GATGCAGGCCTGCCTGAACCAGCCCGCCGAGGCGCTGCCCGATCCCGACGCGCTGGCCGAGACGCTGCGC
CCGGCGCTCTACAAGGCGTTCAAGCCGGCCTTCCTCGGCCGCATGAAGGTGGTGCCGTATTATCCGATCT
CGGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAGCGGATCGCGCGGCGCATCGAGGCGAACCA
CAAGGCCCGCTTCGAGTGGGACGAGTCGCTGGTGGACGCCGTGCTGGCGCGCTGCACCGAGGTGGATTCG
GGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCCGAGATCGCCGGCCATGTGCTCGAAC
GGCTCGCCGAGGGCAGCGCGATCGAGCGCATCGCCGTGCGCGCGAGCGAGGCGGGCGAGTTCGAGTACAC
CGTCAAGTAA