SecReT6
Protein ID: 238026068
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03960
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]410265..411407 [+]
Producttype VI secretion system protein TssA
NoteTssA
UniProt IDC5AA72
KEGG IDbgl:bglu_1g03960
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-22, Aligned region: 55..116
Protein Sequence: 380 a.a.     [Download]
>gi|238026068|ref|YP_002910299.1| unnamed protein product [Burkholderia glumae BGR1]
MPIHVNALLAPLSEASPCGDDLLFSSEFDAIQHARKFDDPSLDQGEWVTEIKEADWGFVVDQSVALLGTR
TKDLRLAVWLTEGLGIQEGVAGLTQGYELLAGLCRTWWDAVHPLPEGDDLDYRLGNVGWLSGRTAELLRM
VPLTDGSGSAYSALDWEVAQHVAQAVRRDPDNAGEIARNKPTVEQIEASKRMTSVAFYAGLLANLSAFRA
ALDALDDELERRAGNAAPSFRQAREAYDSVRMLAERFAKEQGYAPDAQPVAPPPPVVQGGPAERSEPSFK
TPFTPEPHPPMPTAQPVAVHVPAPTVIAGIHNRAQAVEQLRAVAKYFRATEPHSPVAYLADKAAEWADMP
LHLWLESVVKDDGSLAHLRELLGVKRDDNA
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|339905954|ref|NC_012724.2|:410265-411407 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGCCGATTCACGTCAATGCGCTGCTCGCGCCCCTGAGCGAAGCCTCGCCCTGCGGCGACGACCTGCTGT
TCTCGTCCGAGTTCGACGCCATCCAGCACGCGCGCAAGTTCGACGATCCCTCGCTCGATCAGGGCGAATG
GGTCACCGAGATCAAGGAGGCCGACTGGGGCTTCGTGGTGGACCAGTCGGTCGCGCTGCTCGGCACCCGC
ACCAAGGACCTGCGGCTCGCTGTCTGGCTCACCGAGGGGCTGGGCATCCAGGAGGGCGTGGCCGGGCTCA
CCCAGGGCTACGAACTGCTGGCCGGGCTGTGCCGCACCTGGTGGGACGCCGTGCATCCGCTGCCGGAGGG
CGACGACCTCGATTACCGGCTCGGCAACGTCGGCTGGCTGTCGGGCCGCACCGCCGAGCTGCTGCGCATG
GTGCCGCTCACCGACGGCTCGGGCAGCGCCTACAGCGCGCTCGACTGGGAGGTGGCGCAGCATGTTGCGC
AGGCGGTGCGGCGCGACCCCGACAACGCCGGCGAGATCGCGCGCAACAAGCCCACCGTCGAACAGATCGA
GGCCTCGAAGCGGATGACCTCGGTGGCGTTCTACGCCGGCCTGCTGGCCAACCTGAGCGCGTTCCGCGCG
GCGCTCGACGCGCTCGACGACGAACTCGAACGGCGCGCCGGCAACGCCGCGCCGAGCTTCCGGCAGGCAC
GCGAGGCCTATGACTCGGTGCGCATGCTGGCCGAGCGCTTCGCCAAGGAGCAGGGCTATGCGCCCGACGC
GCAGCCCGTCGCGCCGCCGCCGCCCGTCGTGCAGGGCGGCCCCGCCGAGCGCAGCGAACCGAGTTTCAAG
ACCCCGTTTACGCCCGAACCGCACCCGCCGATGCCCACCGCCCAGCCCGTCGCCGTCCACGTCCCCGCGC
CGACCGTGATCGCCGGCATCCATAACCGCGCGCAGGCGGTCGAGCAGCTGCGTGCCGTGGCCAAGTACTT
CCGCGCCACCGAGCCGCACAGCCCGGTCGCCTATCTGGCCGACAAGGCGGCCGAATGGGCCGACATGCCG
CTGCACCTGTGGCTCGAATCGGTGGTGAAGGACGATGGCTCGCTCGCGCATCTGCGCGAGCTGCTCGGCG
TGAAGCGCGACGACAACGCTTGA