SecReT6
Protein ID: 238894408
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2392
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2298791..2299351 [+]
Producthypothetical protein
NoteTssB
UniProt IDC4X7G7
KEGG IDkpu:KP1_2392
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.80E-53, Aligned region: 29..181
Protein Sequence: 186 a.a.     [Download]
>gi|238894408|ref|YP_002919142.1| hypothetical protein KP1_2392 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MLYHRHVSHQYIFNNYFLRKGTAMADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKEN
RPLSEREKINVNKNNFNSVLSEFSPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAML
AMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2298791-2299351 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
TTGCTTTATCATCGTCACGTTTCACATCAATATATCTTCAATAATTATTTCTTAAGGAAAGGAACTGCTA
TGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCGG
CGCGCAAAAGAAGGTCGAACTGCCGCTCAAACTGCTTACCATTGGCGATTTTAGTCATGGTAAGGAAAAC
CGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTTA
GCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGCG
TTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGCGCCATGCTG
GCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTTG
AGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAATA
A