SecReT6
Protein ID: 238894409
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2393
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2299388..2300938 [+]
Producthypothetical protein
NoteTssC
UniProt IDC4X7G8
KEGG IDkpu:KP1_2393
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-171, Aligned region: 90..512
Protein Sequence: 516 a.a.     [Download]
>gi|238894409|ref|YP_002919143.1| hypothetical protein KP1_2393 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MLMSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAERLTAAMQV
FMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTE
ILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAA
HMPFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVK
IPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKL
YAVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2299388-2300938 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGCTAATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGCGCGG
GCGAGGGCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCACCCCGGCGTCTCGCCTCGGGGATATCAA
CGACTTTCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTG
TTTATGGAACGCATCCGTCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGACCACCATA
TCGCCGAGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGT
CGAATCCCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAG
ATCCTCGACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCC
TCTACTGGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGC
CTATGAGTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCC
CATATGCCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCA
TTAAGGATATCGGCAACTACTTCGATCGTGCGGAATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGA
TGCCCGCTACATCGGTCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCG
GTGCGCAGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGACCACGAAAAGTATCTCTGGACCAGCGCGG
CGTTCTCCTTCGCTTCCAATATGGTGAAGAGCTTTGTCAATAACGGCTGGTGCGTGCAAATTCGCGGTCC
GCAGGCCGGCGGCGCGGTGAAAGATCTGCCCATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAA
ATTCCTTCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGT
CGTACTACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGA
TACCGCCGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTATATCTTCCTGCTGTCGCGCATC
GCGCACTACCTGAAGATGATCCAGCGCGAGAATATCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGG
AGCTGAACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCA
TCCGCTGCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTG
TACGCGGTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGG
CGAAGGCGTAG