SecReT6
Protein ID: 238894410
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2395
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2300951..2302291 [+]
Producthypothetical protein
NoteTssK
UniProt IDC4X7G9
KEGG IDkpu:KP1_2395
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|238894410|ref|YP_002919144.1| hypothetical protein KP1_2395 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQD
GTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDTR
QIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLVQLRAR
LTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSLT
HQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLSV
RSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2300951-2302291 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGGCTG
CGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGAGGC
GACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAGGAT
GGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCGGCG
AGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGAGGT
GGCCGAAAGGCCGGTGCGCTTCCGCCAGCGCTGGCGCGATGTCCGCAACCAGTTTGGGGATGATACCCGG
CAGATTGCCGTCATACAGCCGGAGCTGATCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGACCT
GTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCCGCT
GCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCTCGT
CTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTGGCTGATGTCT
CTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCGGCA
AAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTCACC
CATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTGATT
TACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGGGTGGTGGCGATTGCGCTGGAGCATGATGTCCG
GCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCGGTT
CGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGGATC
ATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGCGGC
GATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCAACGGAAATGCTG
CAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGGTAC
TACGAACGTGA