SecReT6
Protein ID: 238894411
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2396
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2302288..2302977 [+]
Producthypothetical protein
NoteTssL
UniProt IDC4X7H0
KEGG IDkpu:KP1_2396
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|238894411|ref|YP_002919145.1| hypothetical protein KP1_2396 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVERVQHELKASGLDDASCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRDVLREPAPNLAVVTCFQRVML
LGFIGSFRSLHDPERLKLVNALGERVPPFQCPATAPVLVESRAGLGISGWLAPWPVRIGLSVVVVLALWW
GLNHWLDHLLLTLLPGEVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2302288-2302977 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTGC
AGGTTATCAGCCTGCGCCACGGCCCGCAGTTCCGCGATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGCGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGCCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCAGTGAAAGGTCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGACGCCGGCGACACCCTGTGCGAGCG
GATGCGTGATGTGTTGCGTGAACCGGCGCCCAACCTGGCCGTGGTCACCTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTATTGGCAGCTTTCGCTCCCTCCACGACCCCGAGCGCCTGAAGCTGGTCAACGCGCTCGGTG
AGCGTGTTCCTCCTTTTCAGTGCCCGGCTACCGCTCCCGTACTGGTAGAGAGTCGCGCCGGTCTGGGGAT
AAGCGGCTGGCTGGCCCCATGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGCCCTGTGGTGG
GGGCTCAACCACTGGCTCGATCACCTGCTGCTGACCTTGTTACCGGGGGAGGTGAAATGA