SecReT6
Protein ID: 238894412
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2397
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2302974..2304680 [+]
Productputative outer membrane protein
NoteTagL
UniProt IDC4X7H1, C4X7H1
KEGG IDkpu:KP1_2397
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 151..159
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 438..534
DUF4131 [PF13567], Evalue: 0.0024, Aligned region: 9..74
DUF4131 [PF13567], Evalue: 0.0024, Aligned region: 302..351
Protein Sequence: 568 a.a.     [Download]
>gi|238894412|ref|YP_002919146.1| putative outer membrane protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSPAQQRGLALWASLLSALVCLLFLPVPRWGAWLILLVTLALIIGIWRIASRRTGRNVASTLAPLPEGAY
RQPVVLVCGDLPCVWPPASPVRVVKQGCWIRVEKTEDLQQVARQVLSQRPEWGPQLSVLLCVCPQRHAQS
DALTSALLALRWQLSQLRQQTGYAVPLALQGQVGSAMSRDLLWQAAIPGEAVKVWQPSCAPCSVPAWVSA
GGAAALEQQVLMNSLMGWFEQHVHAVLTEENTDLPPLPPAAVLWGLGPSLPGSLASSAWTTWLSRHSGLS
RVAGWQPGESDTGDASALPEFILPQLPAGRGLTPRGWAWRAALAIFTLAAVAALLSSGWNNRQLLQRVGV
DIARYERIAMDDYRPKASAVRVLREDAALLDSWARNGVPLRLSLGLYHGEQIRLPLLEAIRGYVPPPPPP
RPVQHVAPDVIRLDSMSLFDTGKWVLKPGSTKRLVSSLMDIKARPGWLIVVAGHTDSVGEEKANQLLSLK
RAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQVDACRLPDQPSASSQDD
GASLHNGE
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2302974-2304680 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAGCCCCGCGCAGCAGCGTGGGCTGGCGCTGTGGGCCAGTCTGCTGAGTGCGCTGGTGTGCCTGCTAT
TTTTGCCGGTTCCCCGCTGGGGGGCGTGGCTCATTCTGCTGGTCACGCTGGCCCTGATCATCGGGATCTG
GCGCATCGCCAGTCGTCGTACCGGACGTAACGTCGCATCAACCCTGGCCCCTCTCCCGGAGGGCGCTTAT
CGCCAGCCGGTGGTCCTCGTTTGCGGCGACCTGCCGTGTGTCTGGCCGCCAGCGTCACCGGTGCGAGTCG
TCAAACAGGGCTGCTGGATCCGCGTGGAAAAGACGGAGGATCTGCAGCAGGTCGCGCGCCAGGTATTGAG
CCAGCGGCCGGAATGGGGGCCTCAGCTGTCGGTGCTGCTCTGCGTCTGCCCGCAGCGGCATGCGCAAAGC
GATGCGCTGACCAGCGCTCTGCTGGCCCTGCGCTGGCAACTCAGCCAGCTGCGTCAGCAGACGGGGTATG
CCGTACCGCTGGCGCTGCAGGGGCAGGTGGGCAGCGCGATGAGTCGCGACCTGTTGTGGCAGGCGGCGAT
ACCGGGTGAAGCGGTGAAAGTCTGGCAGCCCTCCTGCGCCCCCTGTTCCGTACCGGCCTGGGTAAGCGCC
GGCGGGGCGGCCGCGCTGGAGCAGCAGGTGCTGATGAACAGCCTGATGGGCTGGTTTGAACAGCACGTCC
ATGCCGTGTTGACGGAAGAGAATACCGACCTGCCACCTCTGCCCCCTGCGGCCGTGCTGTGGGGCCTCGG
GCCCTCGCTGCCTGGAAGTCTGGCATCGTCGGCCTGGACGACGTGGTTATCCCGACATAGCGGCCTGTCG
CGGGTAGCTGGCTGGCAGCCTGGCGAGAGCGACACCGGGGACGCTTCAGCTTTGCCGGAATTCATCCTGC
CGCAGTTACCGGCGGGACGGGGACTCACGCCACGAGGCTGGGCCTGGCGCGCGGCGCTCGCGATTTTCAC
CCTCGCGGCTGTCGCCGCGCTGCTCAGCAGTGGCTGGAACAATCGACAACTGCTGCAGCGCGTGGGCGTC
GATATTGCCCGTTATGAGCGGATTGCGATGGATGATTATCGACCAAAAGCCAGCGCTGTCAGGGTGCTGC
GTGAAGATGCCGCGCTGCTCGATAGCTGGGCGCGTAACGGCGTCCCGCTGCGCCTGAGTCTGGGCTTGTA
TCACGGGGAGCAGATTCGCCTGCCGTTGCTGGAGGCGATTCGCGGTTACGTGCCGCCTCCGCCTCCGCCC
AGGCCGGTGCAGCACGTCGCGCCGGATGTCATCCGCCTTGACAGCATGTCGCTATTCGATACCGGGAAAT
GGGTACTGAAGCCTGGTTCGACAAAGCGGCTGGTCAGCTCGCTGATGGACATTAAGGCCAGGCCCGGGTG
GCTGATCGTGGTGGCGGGTCACACCGACAGCGTGGGTGAGGAAAAAGCCAACCAGCTATTGTCGCTGAAA
CGTGCCGAATCGGTCCGCGACTGGATGCGCGATACCGGCGACGTGCCGGACAGCTGCTTTGCCGTTCAGG
GCTATGGCGAAAGCCGACCAATTGCAACAAACGATACGCCGGAAGGCCGTGCGCTGAACCGTCGTGTCGA
AATCAGTCTGGTGCCGCAGGTAGACGCCTGCCGGTTACCGGACCAACCCTCTGCGTCATCCCAGGATGAT
GGCGCTTCACTACACAATGGAGAGTAA