SecReT6
Protein ID: 238894414
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2399
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2305440..2308094 [+]
Productputative protease
NoteTssH
UniProt IDC4X7H3
KEGG IDkpu:KP1_2399
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-40, Aligned region: 236..257
AAA_2 [PF07724], Evalue: 2.70E-40, Aligned region: 610..775
AAA [PF00004], Evalue: 8.70E-20, Aligned region: 238..350
AAA [PF00004], Evalue: 8.70E-20, Aligned region: 615..736
AAA_5 [PF07728], Evalue: 5.70E-15, Aligned region: 238..257
AAA_5 [PF07728], Evalue: 5.70E-15, Aligned region: 336..368
AAA_5 [PF07728], Evalue: 5.70E-15, Aligned region: 614..734
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 784..855
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 139..157
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 215..255
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 451..511
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 583..651
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 678..709
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 754..799
AAA_25 [PF13481], Evalue: 2.40E-09, Aligned region: 238..312
AAA_25 [PF13481], Evalue: 2.40E-09, Aligned region: 610..643
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 611..636
AAA_19 [PF13245], Evalue: 2.40E-08, Aligned region: 235..260
AAA_19 [PF13245], Evalue: 2.40E-08, Aligned region: 610..636
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 216..252
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 607..630
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 684..697
NACHT [PF05729], Evalue: 3.50E-06, Aligned region: 238..277
NACHT [PF05729], Evalue: 3.50E-06, Aligned region: 614..639
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 232..298
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 614..634
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 232..254
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 600..654
Sigma54_activat [PF00158], Evalue: 3.30E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 3.30E-05, Aligned region: 614..731
Clp_N [PF02861], Evalue: 6.20E-05, Aligned region: 22..58
Clp_N [PF02861], Evalue: 6.20E-05, Aligned region: 105..121
AAA_17 [PF13207], Evalue: 7.10E-05, Aligned region: 238..286
AAA_17 [PF13207], Evalue: 7.10E-05, Aligned region: 613..649
AAA_23 [PF13476], Evalue: 0.00024, Aligned region: 238..269
AAA_23 [PF13476], Evalue: 0.00024, Aligned region: 611..638
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 238..334
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 612..696
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 232..255
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 610..638
AAA_33 [PF13671], Evalue: 0.0013, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0013, Aligned region: 394..437
AAA_33 [PF13671], Evalue: 0.0013, Aligned region: 613..635
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 238..255
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 615..644
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 239..259
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 712..732
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 851..883
AAA_30 [PF13604], Evalue: 0.0067, Aligned region: 235..260
AAA_30 [PF13604], Evalue: 0.0067, Aligned region: 611..636
AAA_28 [PF13521], Evalue: 0.0094, Aligned region: 238..259
AAA_28 [PF13521], Evalue: 0.0094, Aligned region: 614..634
ResIII [PF04851], Evalue: 0.0097, Aligned region: 223..251
ResIII [PF04851], Evalue: 0.0097, Aligned region: 308..320
ResIII [PF04851], Evalue: 0.0097, Aligned region: 588..642
Protein Sequence: 884 a.a.     [Download]
>gi|238894414|ref|YP_002919148.1| putative protease [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MENPASLLRRLNPCCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
SWLDKQPRSVRHRPQLSHHTLRLMQEAWLIASLSGEAQIRSVHLLMALVEKQNLIQCDGLWPLLTLGQRQ
LERLRPLLDAQSDERPPAQQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALDKFTLDVTAKARDG
LIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALCIAEGNVPDALKPVSVRTLDLGLL
QAGAGVKGEFEQRLKNIIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARLRMSLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLI
LALDTLETQYGQELQLTEALLACRRDISRQAEISDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVP
LSSLMKDEQTELLSLEESLGKRVVGQEAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTETALA
LADALFGGEKALITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGVMRDGEGREIDFRNTVILMTANLGSDLLMQLLDEQPEASESDLHELLRPVLRGHFQPALL
ARFQTVIYRPLPAGALRAIVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGARNVDSLLNQQ
ILPALSQQLLSHMAAGQKPRQVTLGYHEEEGVVMAFDEGTISDE
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2305440-2308094 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGAAAATCCAGCCAGCCTGTTACGCCGTCTTAATCCCTGCTGTGCCCGCGCAATGGAGGGGGCGGCCT
CCCTGTGCCAGACCCGGGCGCATGCCGAGATCCTGCCCGAGCACTGGCTGCTCAAGCTGCTGGAACAGGG
GGAAGGCGATCTGACGGTGCTGGCGCGGCGCTATGAATGGGATATGGATGCGCTGTGGCAGGATCTGCTG
AGCTGGCTGGATAAACAGCCGCGCTCGGTACGTCATCGTCCCCAGCTCTCTCACCATACCCTGAGGCTGA
TGCAGGAGGCCTGGCTGATTGCCTCTCTCAGCGGCGAAGCGCAGATCCGCAGTGTTCACCTGCTGATGGC
GCTGGTTGAAAAACAGAATCTGATCCAGTGCGATGGCCTGTGGCCGCTGTTAACGCTGGGCCAGCGTCAG
CTGGAACGCCTGCGCCCCTTGCTGGATGCCCAGTCCGACGAACGTCCGCCAGCGCAGCAGGAAGCGGCGC
TTGCGCAGCCCCATGGCGGGGACGTGGAATTTGTGGGGCGTCCCGCGGGCAGCGAACTGAATGCGGATGG
GCTCAACCCGGCGCTGCAGAACGCGCTGGACAAATTCACTCTCGACGTCACCGCCAAAGCCAGAGACGGC
CTGATTGACCCGGTGTTCGGACGTGACACGGAAATCCGCCAGATGGTGGATATTCTCTCCCGTCGACGTA
AAAACAACCCGATCCTCGTCGGTGAGCCGGGCGTGGGCAAGACCGCTCTGGTGGAAGGCCTGGCGCTGTG
CATTGCCGAAGGCAACGTCCCCGACGCGCTGAAGCCGGTGTCGGTGCGCACCCTCGACCTCGGTCTGCTG
CAGGCCGGCGCCGGGGTCAAAGGCGAGTTCGAGCAGCGGCTGAAAAATATCATTGAGGCGGTACAGCAGT
CGCCTTCGCCGGTGCTGCTGTTTATCGACGAGGCGCACACGATCATCGGCGCGGGTAATCAGGCGGGCGG
CGCGGATGCCGCCAACCTGTTGAAGCCGGCTCTGGCCCGGGGCGAGCTGCGGACCATCGCCGCCACCACC
TGGAGTGAATACAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGCTTTCAGATGGTCAAGGTGG
ATGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCTATGCCGACCACCACGG
CGTGCATATCACGGATGATGCGGTGCGCGCCGCCGTGACGCTGTCACGACGCTATCTCACCGGTCGCCAG
CTGCCGGACAAGGCAGTGGATTTACTCGACACCGCTTCCGCCCGCCTGCGTATGAGTTTGGATACCGTGC
CTGAGCCGCTGACCCGCATGAAGGCGCAGCTCACCGCGCTGGCGATGGAGAAGCAGGCGCTGCTGGAAGA
TATTGCGCTGGGCAACAGCGCCCGCGGCGATCGGCTGGCGGCCATTGAGCAGGAGGAGATCCGTCTTATT
CTGGCGCTGGATACCCTTGAAACTCAGTATGGTCAGGAGCTGCAGCTGACGGAAGCGCTGCTCGCCTGCC
GCCGCGATATCTCCCGCCAGGCGGAAATTAGCGATCTACAAACCGCGCTTATCGCCGTCCAGCAGGGCAA
TCCGCTGCTCGGGCTGGACGTCGACGTCCGCACCGTGGCGACGGTGATTGCCGACTGGACCGGCGTGCCG
CTCTCCTCGCTAATGAAAGATGAGCAGACGGAGCTGCTGAGTCTGGAAGAGAGTCTCGGCAAACGGGTGG
TTGGCCAGGAGGCGGCCCTGAGCGCTATTGCCCGGCGCCTGCGCGCCGCGAAAACCGGCCTGACGCCGGA
GAACGGTCCGCAAGGGGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAACGGAAACGGCGCTCGCC
CTGGCCGATGCGCTGTTCGGCGGCGAGAAAGCGCTGATCACCATCAATCTCTCCGAGTACCAGGAGCCGC
ACACCGTCAGCCAGCTGAAGGGTTCTCCGCCCGGCTACGTCGGCTACGGCCAGGGCGGGATCCTGACCGA
GGCGGTGCGCAAACGCCCCTACAGCGTGGTGCTGCTCGATGAGGTGGAAAAGGCCCATCGCGATGTGATG
AACCTGTTCTACCAGGTCTTCGACCGGGGGGTAATGCGCGACGGCGAGGGGCGTGAAATCGACTTTCGCA
ACACCGTGATCCTGATGACCGCCAACCTCGGAAGCGACCTCCTGATGCAGTTGCTGGATGAACAGCCGGA
GGCCAGCGAATCAGACCTGCACGAGCTGCTGCGCCCGGTGCTGCGCGGCCACTTCCAGCCGGCGCTGCTG
GCCCGCTTCCAGACGGTGATTTACCGTCCGCTGCCGGCGGGAGCGCTGCGCGCCATTGTCGGCATGAAGC
TCGGGCAGGTAAGTCAGCGTCTGGCTTGCCATTACGGAATCACCACCACCCTCAGCGAGAGCCTGTTCGA
CGCGCTGACCGAGGCCTGCCTGCTGCCGGATACCGGCGCCCGTAACGTCGACAGTCTGCTCAATCAGCAG
ATCCTGCCGGCACTGAGTCAGCAGCTATTGAGCCATATGGCGGCGGGGCAGAAACCGCGCCAGGTGACGC
TGGGGTATCACGAAGAGGAAGGCGTCGTGATGGCGTTTGACGAGGGGACAATATCCGATGAGTAG